Player Messerknecht has no weapon equipped at the Main-Hand slot.

SimulationCraft 1100-02

for World of Warcraft 11.0.7.58911 Live (hotfix 2025-02-03/58911, git build d2465f0)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Combo 1 : 1,472,605 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,472,605.21,472,605.22,681.4 / 0.182%190,726.9 / 13.0%49,281.6
Resource Out In Waiting APM Active
Energy29.829.711.70%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 11,472,605
Auto Attack 0 (70,141)0.0% (4.8%)3.9122.45s5,356,7540

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,8483.2%354.80.98s39,62740,525Direct354.838,39977,35139,62719.3%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.79354.790.000.000.000.97780.000014,059,139.6518,342,940.8623.35%40,524.8940,524.89
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.30%228.1316629538,398.9723,90764,93938,415.8336,45040,4658,760,19811,430,21723.36%
crit19.31%68.503811277,350.7349,962130,05577,400.3570,13788,7905,298,9416,912,72423.35%
miss16.39%58.1533880.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,2921.6%354.40.98s19,72320,101Direct354.419,12138,59119,72519.2%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.36354.360.000.000.000.98120.00006,989,033.679,118,717.5823.36%20,101.1120,101.11
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.32%227.9116629519,120.6511,77632,33719,127.9518,17120,1394,357,8875,686,24723.36%
crit19.24%68.193910538,591.2523,90164,76238,609.8633,95342,8892,631,1473,432,47123.35%
miss16.44%58.2634870.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,3192.1%75.63.69s120,557120,016Direct75.672,965188,865120,54041.1%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.6475.640.000.000.001.00450.00009,119,317.7211,931,804.5723.57%120,016.29120,016.29
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.95%44.59226972,964.8857,139141,59472,970.7967,81677,6843,253,8534,259,69923.60%
crit41.05%31.051548188,865.48125,912385,246188,959.18173,091208,6585,865,4657,672,10623.57%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.64

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 89,287 (127,331)6.1% (8.7%)13.322.51s2,885,3012,395,563Direct39.7 (77.8)521,7371,043,990675,53329.4% (29.2%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2539.690.000.000.001.20450.000026,810,350.0634,907,515.3323.20%2,395,562.822,395,562.82
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.56%28.001545521,737.17119,7432,007,170521,942.36341,163711,81414,604,25919,015,82123.20%
crit29.44%11.694271,043,990.11239,8463,646,2931,045,831.48486,5571,737,14412,206,09115,891,69523.20%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.25
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,0442.6%0.00.00s00Direct38.1231,287466,746299,61529.0%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.130.000.000.000.00000.000011,420,437.0311,420,437.030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.00%27.071443231,287.1356,790870,782231,516.21150,411317,7826,261,8736,261,8730.00%
crit29.00%11.06124466,745.79114,3451,683,660467,954.96213,504843,1935,158,5645,158,5640.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,095)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,0951.4%22.412.87s269,7000Direct22.4269,8070269,8070.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.3922.380.000.000.000.00000.00006,037,993.996,037,993.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.381037269,807.23260,578318,025269,777.26263,471279,1846,037,9946,037,9940.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 255,630 (365,785)17.3% (24.8%)68.74.37s1,596,7451,589,594Direct68.7 (136.0)856,1401,760,4851,116,24528.8% (28.9%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.6868.680.000.000.001.00450.000076,637,155.1399,695,214.1823.13%1,589,593.521,589,593.52
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.23%48.923267856,139.64210,8622,414,665855,969.16717,0811,049,77641,875,70054,477,84923.13%
crit28.77%19.767361,760,484.75422,3574,846,2401,760,844.141,249,9922,429,45034,761,45545,217,36523.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.68

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,1557.5%67.34.46s490,4670Direct67.3377,120769,044490,51128.9%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.3367.330.000.000.000.00000.000033,020,953.5933,020,953.590.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.05%47.842865377,120.25100,5271,049,661377,124.83312,065442,54418,034,88918,034,8890.00%
crit28.95%19.49836769,043.76201,3562,084,929769,526.61471,0691,122,83914,986,06514,986,0650.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,044 (20,986)0.1% (1.4%)3.791.44s1,693,8511,686,428Direct3.7 (27.6)69,726139,45083,97320.5% (19.7%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.723.720.000.000.001.00450.0000312,388.34312,388.340.00%1,686,427.941,686,427.94
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.53%2.960469,726.4260,925135,16969,432.08097,629206,236206,2360.00%
crit20.47%0.7603139,450.14122,033255,48378,456.190223,997106,152106,1520.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 19,9421.4%0.00.00s00Direct23.9209,811420,120250,94319.6%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.850.000.000.000.00000.00005,986,420.015,986,420.010.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.44%19.19927209,810.7173,943443,509209,648.50173,285244,9814,025,5094,025,5090.00%
crit19.56%4.67011420,120.19158,494890,382416,102.200819,0021,960,9111,960,9110.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,1960.8%0.00.00s00Direct283.210,80321,70112,92019.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00283.160.000.000.000.00000.00003,658,382.583,658,382.580.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.59%228.1914630410,803.257,51417,72310,806.7610,16811,4052,465,2472,465,2470.00%
crit19.41%54.97288721,701.4815,05135,50521,710.4619,19624,2511,193,1361,193,1360.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,717 (116,893)6.7% (7.9%)9.631.35s3,668,1223,651,982Periodic167.6 (335.2)135,590281,106176,72328.3% (28.3%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.560.00167.61167.617.091.00451.740429,623,239.0729,623,239.070.00%116,419.803,651,982.01
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.71%120.1984160135,590.20125416,363135,628.38119,914152,52716,291,95516,291,9550.00%
crit28.29%47.412674281,106.47348857,465281,424.54218,217364,41013,331,28413,331,2840.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.56
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1761.2%167.61.76s32,5410Periodic167.624,93051,75132,54628.4%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.610.000.00167.610.000.00000.00005,454,048.105,454,048.100.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.61%120.028216124,930.179,67178,43724,945.4422,29428,2232,991,5292,991,5290.00%
crit28.39%47.59237851,750.7819,371157,22651,806.8237,99567,0462,462,5192,462,5190.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (271,534)0.0% (18.4%)16.018.97s5,083,0665,060,285

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.030.000.000.000.001.00450.00000.000.000.00%5,060,285.455,060,285.45

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.02
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,5204.7%0.00.00s00Direct16.0687,4172,128,1871,302,23842.6%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.030.000.000.000.00000.000020,858,074.2427,190,761.3623.29%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.36%9.19315687,416.82151,5591,610,850687,536.84398,321937,7346,314,1548,251,74423.48%
crit42.64%6.833142,128,186.87303,5724,195,6852,170,605.891,236,8893,380,80614,543,92018,939,01823.20%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 202,01413.7%0.00.00s00Direct32.0995,1293,050,2071,897,31643.9%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.950.000.000.000.00000.000060,602,400.8760,602,400.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.09%17.92927995,128.85222,2922,329,481996,117.46704,5281,353,79917,819,35217,819,3520.00%
crit43.91%14.037243,050,206.75446,6846,067,4593,076,804.872,039,7124,391,50442,783,04842,783,0480.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (104,761)0.0% (7.1%)3.690.95s8,622,3540

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 104,7617.1%385.51.21s81,5660Periodic385.581,562081,5620.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage385.540.000.00385.540.000.00000.000031,447,004.9331,447,004.930.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%385.5429347281,561.82401,099,12781,625.2366,20997,51431,447,00531,447,0050.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5238.63
  • base_dd_max:5238.63
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,5808.0%52.35.83s673,948670,943Direct52.3280,785916,448674,03661.9%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2852.280.000.000.001.00450.000035,233,920.6945,943,303.9423.31%670,943.38670,943.38
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.14%19.941129280,785.02130,261417,492280,695.85251,304309,6375,597,6817,292,81823.25%
crit61.86%32.342248916,447.53287,0431,426,954917,316.12836,969992,91529,636,24038,650,48623.32%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.27

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,7860.3%2.468.53s473,9710Direct2.4401,132802,147474,22718.2%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.402.390.000.000.000.00000.00001,135,368.201,135,368.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.77%1.9607401,131.97377,346477,554347,976.330474,911785,157785,1570.00%
crit18.23%0.4404802,147.14755,824926,273285,035.750926,273350,212350,2120.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8550.1%2.371.54s110,1990Direct2.391,567184,095110,17420.1%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.332.330.000.000.000.00000.0000257,187.20257,187.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.90%1.8601091,567.1583,958120,19376,271.170119,402170,782170,7820.00%
crit20.10%0.4704184,094.82168,168238,35769,181.500238,35786,40686,4060.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67920.01
  • base_dd_max:67920.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,5013.2%19.315.53s740,5480Periodic107.7132,4480132,4480.0%0.0%71.7%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.270.00107.75107.7512.320.00002.000014,273,138.6314,273,138.630.00%66,235.120.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.7562157132,448.1760,995223,228131,469.7872,204182,40814,273,13914,273,1390.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 73,1175.0%37.07.96s594,1570Direct37.0497,042999,520594,21119.3%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage36.9736.970.000.000.000.00000.000021,967,094.7521,967,094.750.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.68%29.831553497,041.53453,001874,950496,882.00466,276544,42114,826,98414,826,9840.00%
crit19.32%7.14017999,520.48907,3601,715,818997,979.8001,419,9357,140,1117,140,1110.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,4450.3%2.375.60s574,9400Direct2.3481,186965,656574,77719.4%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.322.320.000.000.000.00000.00001,334,384.661,334,384.660.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.64%1.8708481,185.83452,539589,120409,088.620566,868900,468900,4680.00%
crit19.36%0.4505965,656.44906,4361,150,761344,262.5201,150,761433,917433,9170.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,2835.8%58.05.19s441,2550Direct58.0367,518741,897441,25119.7%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.0258.020.000.000.000.00000.000025,601,195.2933,444,546.9423.45%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.30%46.592968367,517.83220,828572,381367,740.44334,496397,71117,123,59722,372,89823.46%
crit19.70%11.43225741,896.65442,3191,135,936741,594.63513,761893,7648,477,59811,071,64923.44%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 1
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.81s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.560.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.43s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.740.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.711.50s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.660.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.475.39s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.380.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.368.78s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.340.0068.780.000.330.00000.83470.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5307.56s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 99.03.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.960.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.467.64s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.380.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.17s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.30
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.371.54s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.332.330.000.000.000.00000.00000.001,602,481.170.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.330100.00000.000001,602,48189.73%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8550.1%2.371.54s110,1990Direct2.391,567184,095110,17420.1%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.332.330.000.000.000.00000.0000257,187.20257,187.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.90%1.8601091,567.1583,958120,19376,271.170119,402170,782170,7820.00%
crit20.10%0.4704184,094.82168,168238,35769,181.500238,35786,40686,4060.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67920.01
  • base_dd_max:67920.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.39s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.30
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.45s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.377.29s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1591.7169.4s0.5s278.2s99.94%100.00%582.0 (582.0)0.1

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:11.5s / 321.3s
  • trigger_min/max:0.0s / 4.3s
  • trigger_pct:100.00%
  • duration_min/max:2.4s / 359.8s
  • uptime_min/max:99.06% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.24%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.17%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.33%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.5115.1s3.5s125.1s97.31%0.00%74.0 (76.8)1.3

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 301.7s
  • trigger_min/max:1.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.9s
  • uptime_min/max:87.96% / 99.44%

Stack Uptimes

  • alacrity_1:3.07%
  • alacrity_2:2.30%
  • alacrity_3:1.81%
  • alacrity_4:1.65%
  • alacrity_5:88.48%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.50%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.64%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.019.0s19.0s6.9s36.98%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 56.3s
  • trigger_min/max:9.2s / 56.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.70% / 40.77%

Stack Uptimes

  • bolstering_shadows_1:36.98%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.8s90.8s0.2s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:82.4s / 187.1s
  • trigger_min/max:82.4s / 187.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.3s
  • uptime_min/max:0.00% / 0.12%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0130.1s112.6s4.4s1.80%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.2s
  • trigger_min/max:90.0s / 190.4s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 10.3s
  • uptime_min/max:0.00% / 6.78%

Stack Uptimes

  • cryptic_instructions_1:1.80%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.348.023.2s23.2s8.2s36.39%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 73.2s
  • trigger_min/max:8.0s / 73.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.38% / 39.54%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.55%
  • danse_macabre_3:6.54%
  • danse_macabre_4:16.42%
  • danse_macabre_5:8.84%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.441.1s3.7s35.8s90.07%95.66%74.4 (74.4)6.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 172.7s
  • trigger_min/max:1.0s / 38.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 158.9s
  • uptime_min/max:79.65% / 96.57%

Stack Uptimes

  • deeper_daggers_1:90.07%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.019.0s19.0s3.4s18.36%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 56.3s
  • trigger_min/max:9.2s / 56.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:14.90% / 21.61%

Stack Uptimes

  • disorienting_strikes_1:12.17%
  • disorienting_strikes_2:6.20%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.30.0130.7s111.6s4.1s1.72%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 276.5s
  • trigger_min/max:90.0s / 203.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 6.98%

Stack Uptimes

  • errant_manaforge_emission_1:1.72%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.022.2s5.2s17.4s81.57%0.00%3.2 (3.2)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 61.7s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:62.01% / 92.58%

Stack Uptimes

  • escalating_blade_1:25.04%
  • escalating_blade_2:22.11%
  • escalating_blade_3:22.47%
  • escalating_blade_4:11.94%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.5s90.5s14.7s18.18%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:82.9s / 180.4s
  • trigger_min/max:82.9s / 180.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:12.82% / 20.87%

Stack Uptimes

  • ethereal_powerlink_1:18.18%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.280.8s69.9s15.2s10.79%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4569.44

Trigger Details

  • interval_min/max:15.0s / 287.8s
  • trigger_min/max:1.0s / 287.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.3s
  • uptime_min/max:0.00% / 39.21%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.79%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.63%0.00%14.3 (96.2)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 97.8s
  • trigger_min/max:1.0s / 87.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.93% / 16.89%

Stack Uptimes

  • flagellation_buff_1:1.32%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.60%
  • flagellation_buff_10:0.56%
  • flagellation_buff_11:0.47%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.01%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.42%
  • flagellation_buff_20:0.40%
  • flagellation_buff_21:0.32%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.01%
  • flagellation_buff_24:0.19%
  • flagellation_buff_25:0.84%
  • flagellation_buff_26:0.36%
  • flagellation_buff_27:0.19%
  • flagellation_buff_28:0.21%
  • flagellation_buff_29:0.00%
  • flagellation_buff_30:7.10%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.22%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.0s / 97.8s
  • trigger_min/max:78.0s / 97.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.30% / 16.23%

Stack Uptimes

  • flagellation_persist_1:0.00%
  • flagellation_persist_26:0.00%
  • flagellation_persist_30:14.22%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6112.7s77.8s35.4s24.84%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:31.0s / 300.0s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 81.98%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.84%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.20.6113.0s78.6s34.8s25.01%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 70.53%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.01%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.4s77.1s35.1s25.00%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.8s / 352.1s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 76.38%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.00%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.7s76.4s35.3s25.15%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 341.4s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 72.57%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.15%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.30.040.2s3.4s60.0s95.40%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.67%
  • flawless_form_2:8.87%
  • flawless_form_3:11.81%
  • flawless_form_4:9.72%
  • flawless_form_5:2.76%
  • flawless_form_6:4.49%
  • flawless_form_7:5.91%
  • flawless_form_8:11.29%
  • flawless_form_9:18.51%
  • flawless_form_10:8.71%
  • flawless_form_11:1.36%
  • flawless_form_12:0.08%
  • flawless_form_13:0.00%
  • flawless_form_14:0.01%
  • flawless_form_15:0.14%
  • flawless_form_16:0.08%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.285.7s71.9s16.8s10.83%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.1s / 296.1s
  • trigger_min/max:0.2s / 296.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.3s
  • uptime_min/max:0.00% / 39.04%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.83%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.286.4s73.3s16.8s10.85%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.0s / 320.7s
  • trigger_min/max:0.3s / 320.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.9s
  • uptime_min/max:0.00% / 37.12%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.85%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.289.4s75.1s17.0s10.62%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.4s / 299.6s
  • trigger_min/max:0.1s / 299.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.7s
  • uptime_min/max:0.00% / 42.30%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.62%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)2.00.287.9s74.0s16.9s11.17%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.0s / 312.5s
  • trigger_min/max:0.2s / 312.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.4s
  • uptime_min/max:0.00% / 41.51%

Stack Uptimes

  • nascent_empowerment_Vers_1:11.17%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.90.422.1s21.3s3.7s17.01%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.5s
  • trigger_min/max:1.0s / 67.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:8.14% / 27.03%

Stack Uptimes

  • poised_shadows_1:17.01%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.63%11.20%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 66.3s
  • trigger_min/max:1.0s / 66.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.3s
  • uptime_min/max:0.81% / 4.98%

Stack Uptimes

  • premeditation_1:2.63%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0132.6s113.3s4.0s1.64%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 276.7s
  • trigger_min/max:90.0s / 189.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 9.6s
  • uptime_min/max:0.00% / 6.88%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.64%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.00.283.5s71.7s15.4s10.39%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23922.58

Trigger Details

  • interval_min/max:15.2s / 330.3s
  • trigger_min/max:1.0s / 330.3s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 43.7s
  • uptime_min/max:0.00% / 37.25%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.39%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.60.090.9s90.9s15.8s19.18%17.14%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.7s
  • trigger_min/max:90.0s / 97.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.71% / 21.87%

Stack Uptimes

  • shadow_blades_1:19.18%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.2s23.2s8.2s36.39%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 73.2s
  • trigger_min/max:8.0s / 73.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.38% / 39.54%

Stack Uptimes

  • shadow_dance_1:36.39%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.3138.34.4s1.5s3.5s79.13%95.45%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 49.9s
  • trigger_min/max:0.5s / 6.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.7s
  • uptime_min/max:70.88% / 86.12%

Stack Uptimes

  • shadow_techniques_1:20.63%
  • shadow_techniques_2:20.86%
  • shadow_techniques_3:9.39%
  • shadow_techniques_4:10.46%
  • shadow_techniques_5:6.05%
  • shadow_techniques_6:5.82%
  • shadow_techniques_7:2.58%
  • shadow_techniques_8:2.32%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.45%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s298.3s99.32%87.79%99.0 (99.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.3s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.40.0117.3s107.4s9.9s1.28%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.2s / 269.3s
  • trigger_min/max:1.2s / 269.3s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 19.0s
  • uptime_min/max:0.00% / 13.06%

Stack Uptimes

  • storm_sewers_citrine_1:1.28%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0115.4s109.5s9.8s1.25%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:5.0s / 319.2s
  • trigger_min/max:7.2s / 319.2s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 17.2s
  • uptime_min/max:0.00% / 11.38%

Stack Uptimes

  • storm_sewers_citrine_1:1.25%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0111.1s93.2s9.9s1.29%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:16.3s / 279.9s
  • trigger_min/max:2.0s / 247.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.8s
  • uptime_min/max:0.00% / 11.11%

Stack Uptimes

  • storm_sewers_citrine_1:1.29%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0122.6s108.8s10.0s1.30%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.5s / 340.8s
  • trigger_min/max:1.9s / 340.8s
  • trigger_pct:100.00%
  • duration_min/max:1.9s / 20.0s
  • uptime_min/max:0.00% / 11.94%

Stack Uptimes

  • storm_sewers_citrine_1:1.30%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0123.8s111.8s9.9s1.24%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:12.3s / 298.6s
  • trigger_min/max:2.0s / 298.6s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 16.2s
  • uptime_min/max:0.00% / 10.91%

Stack Uptimes

  • storm_sewers_citrine_1:1.24%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.20.281.2s69.8s15.4s11.10%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1439.62
  • stat:haste_rating
  • amount:1439.62
  • stat:mastery_rating
  • amount:1439.62
  • stat:versatility_rating
  • amount:1439.62

Trigger Details

  • interval_min/max:15.2s / 287.6s
  • trigger_min/max:0.3s / 286.3s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 42.7s
  • uptime_min/max:0.00% / 41.38%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:11.10%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.4s21.4s2.3s10.94%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 67.4s
  • trigger_min/max:3.0s / 67.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.8s
  • uptime_min/max:8.70% / 13.31%

Stack Uptimes

  • supercharge_1_1:10.94%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.01%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 67.4s
  • trigger_min/max:1.0s / 67.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.6s
  • uptime_min/max:0.40% / 4.97%

Stack Uptimes

  • supercharge_2_1:2.01%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 1.0s
  • uptime_min/max:0.00% / 0.34%

Stack Uptimes

  • supercharge_3_1:0.00%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.5s21.3s24.5s61.10%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.2s / 98.5s
  • trigger_min/max:1.0s / 67.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:55.50% / 65.27%

Stack Uptimes

  • symbols_of_death_1:61.10%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.9s307.9s27.4s13.34%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.8s
  • trigger_min/max:300.0s / 329.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.95% / 18.11%

Stack Uptimes

  • tempered_potion_1:13.34%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.69%3.80%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.69%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.4s21.3s2.9s13.82%22.25%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 67.4s
  • trigger_min/max:1.0s / 67.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.6s
  • uptime_min/max:11.58% / 16.98%

Stack Uptimes

  • the_rotten_1:10.74%
  • the_rotten_2:3.07%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.4s
  • trigger_min/max:120.0s / 136.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.44%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.060.1s35.1s15.1s0.45%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4579.26

Trigger Details

  • interval_min/max:21.8s / 123.8s
  • trigger_min/max:6.0s / 123.8s
  • trigger_pct:100.00%
  • duration_min/max:3.2s / 30.0s
  • uptime_min/max:0.00% / 11.84%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.52%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.00.288.7s74.9s15.4s10.12%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5711.79

Trigger Details

  • interval_min/max:15.3s / 299.7s
  • trigger_min/max:1.0s / 299.7s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 38.0s
  • uptime_min/max:0.00% / 37.25%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.12%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.227.080.06.0s0.7s70.0s
Skyfury (Off Hand)49.326.079.06.0s0.7s63.7s
Supercharger secret_technique12.58.017.023.6s9.2s91.8s
Cold Blood secret_technique3.63.04.090.8s82.4s187.1s
Supercharger rupture0.20.03.0161.7s24.2s270.2s
Supercharger coup_de_grace2.80.08.076.3s9.2s325.1s
Supercharger eviscerate13.07.019.023.2s1.0s151.5s
CP Spent During Flagellation202.1139.0251.011.2s1.0s89.3s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.34%5.87%12.87%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 1
Energy RegenEnergy1,443.763,042.7134.14%2.11397.5211.55%
Improved AmbushCombo Points52.2733.534.58%0.6418.7435.86%
PremeditationCombo Points17.2257.127.80%3.3263.4252.61%
Relentless StrikesEnergy107.514,276.4147.99%39.78124.342.83%
Shadow BladesCombo Points21.94114.0515.57%5.2017.5913.36%
Shadow TechniquesEnergy359.771,233.6513.84%3.43205.4314.27%
Shadow TechniquesCombo Points85.72240.7432.87%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.31107.1714.63%7.000.000.00%
BackstabCombo Points75.6475.2810.28%1.000.360.48%
ShadowstrikeCombo Points52.27104.5114.27%2.000.030.03%
Symbols of DeathEnergy14.30358.924.03%25.11212.9037.23%
Usage Type Count Total Tot% Avg RPE APR
Combo 1
BackstabEnergy75.643,025.6833.75%40.0040.003,013.97
Coup de GraceEnergy13.25463.685.17%35.0034.9982,451.25
Coup de GraceCombo Points13.2590.5012.42%6.836.83422,423.81
EviscerateEnergy68.682,403.7126.81%35.0035.0045,620.33
EviscerateCombo Points68.68467.8064.21%6.816.81234,414.87
RuptureEnergy9.56239.052.67%25.0025.00146,733.58
RuptureCombo Points9.5665.418.98%6.846.84536,293.11
Secret TechniqueEnergy16.02480.725.36%30.0030.00169,453.93
Secret TechniqueCombo Points16.02104.8214.39%6.546.54777,141.49
ShadowstrikeEnergy52.272,352.1126.24%45.0044.9914,979.73
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6729.85939.946.80.1100.0
Combo Points0.02.442.43100.13.90.07.0

Statistics & Data Analysis

Fight Length
Combo 1 Fight Length
Count 1315
Mean 300.36
Minimum 240.36
Maximum 359.90
Spread ( max - min ) 119.55
Range [ ( max - min ) / 2 * 100% ] 19.90%
DPS
Combo 1 Damage Per Second
Count 1315
Mean 1472605.25
Minimum 1280999.10
Maximum 1637438.81
Spread ( max - min ) 356439.71
Range [ ( max - min ) / 2 * 100% ] 12.10%
Standard Deviation 49610.8490
5th Percentile 1392146.19
95th Percentile 1553917.37
( 95th Percentile - 5th Percentile ) 161771.18
Mean Distribution
Standard Deviation 1368.0872
95.00% Confidence Interval ( 1469923.85 - 1475286.65 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4360
0.1 Scale Factor Error with Delta=300 21010529
0.05 Scale Factor Error with Delta=300 84042116
0.01 Scale Factor Error with Delta=300 2101052897
Priority Target DPS
Combo 1 Priority Target Damage Per Second
Count 1315
Mean 1472605.25
Minimum 1280999.10
Maximum 1637438.81
Spread ( max - min ) 356439.71
Range [ ( max - min ) / 2 * 100% ] 12.10%
Standard Deviation 49610.8490
5th Percentile 1392146.19
95th Percentile 1553917.37
( 95th Percentile - 5th Percentile ) 161771.18
Mean Distribution
Standard Deviation 1368.0872
95.00% Confidence Interval ( 1469923.85 - 1475286.65 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4360
0.1 Scale Factor Error with Delta=300 21010529
0.05 Scale Factor Error with Delta=300 84042116
0.01 Scale Factor Error with Delta=300 2101052897
DPS(e)
Combo 1 Damage Per Second (Effective)
Count 1315
Mean 1472605.25
Minimum 1280999.10
Maximum 1637438.81
Spread ( max - min ) 356439.71
Range [ ( max - min ) / 2 * 100% ] 12.10%
Damage
Combo 1 Damage
Count 1315
Mean 441838628.43
Minimum 339313782.92
Maximum 541927617.79
Spread ( max - min ) 202613834.87
Range [ ( max - min ) / 2 * 100% ] 22.93%
DTPS
Combo 1 Damage Taken Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 1 Healing Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 1 Healing Per Second (Effective)
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 1 Heal
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 1 Healing Taken Per Second
Count 1315
Mean 3028.02
Minimum 0.00
Maximum 9563.32
Spread ( max - min ) 9563.32
Range [ ( max - min ) / 2 * 100% ] 157.91%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.27 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.64 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.30 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.02 secret_technique,if=variable.secret
L 9.56 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.25 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.68 eviscerate
actions.item
# count action,conditions
O 3.74 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.71 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.30 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNNDHMDFKNENNENEMELHQDKDNDNDDNENEENHQDNDKDMDNENEENEELHQDKDMDNDNENEEENENEEMEEEOJHQKDPNDINDNNELNQDFKHDMDNNDNNENEEMEEENRDLEEHQKDMDNDNDNENEEKEEMEEELEEENEENEENEOEJHQPKDMIDNNDNELHQNDFKNDNDMNENHQDNDKDNDNENENELEEMEENEEHQKDNDNDNDNENEENRDKELEEEMEENEENEOEJHQPKDIMDNNDNELHQNDFKDNNDMENEEENEENHQDKDNDNDMGEEELEENEEEHQKDNDMDNDNEE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, errant_manaforge_emission
0:01.004Gpotion
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, errant_manaforge_emission
0:01.004Jflagellation
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, errant_manaforge_emission, tempered_potion
0:02.008Neviscerate
[finish]
Fluffy_Pillow 90.2/100 90% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(7), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff, errant_manaforge_emission, tempered_potion
0:03.014Rvanish
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(8), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, errant_manaforge_emission, tempered_potion
0:03.014Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(8), alacrity, flawless_form, premeditation, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, errant_manaforge_emission, tempered_potion
0:04.018Lrupture
[finish]
Fluffy_Pillow 73.0/100 73% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(4), the_first_dance, flagellation_buff(8), deeper_daggers, errant_manaforge_emission, tempered_potion
0:05.023Hsymbols_of_death
[cds]
Combo 1 97.1/100 97% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(4), the_first_dance, flagellation_buff(15), deeper_daggers, errant_manaforge_emission, tempered_potion
0:05.023Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, errant_manaforge_emission, tempered_potion
0:05.023Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, errant_manaforge_emission, tempered_potion
0:05.023Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.029Ishadow_blades
[cds]
Combo 1 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(6), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.029Ksecret_technique
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(6), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.033Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(8), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.037Neviscerate
[finish]
Fluffy_Pillow 77.2/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(10), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.042Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.047Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.052Neviscerate
[finish]
Fluffy_Pillow 69.5/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:12.058Neviscerate
[finish]
Fluffy_Pillow 92.1/100 92% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:13.062Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.068Hsymbols_of_death
[cds]
Combo 1 85.9/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:14.068Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(4), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:15.271Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, tempered_potion
0:16.274Fcold_blood
[cds]
Combo 1 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(10), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, tempered_potion
0:16.274Ksecret_technique
[finish]
Fluffy_Pillow 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(10), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, tempered_potion
0:17.279Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(11), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:18.284Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:19.286Neviscerate
[finish]
Fluffy_Pillow 90.9/100 91% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:20.289Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:21.294Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:22.299Neviscerate
[finish]
Fluffy_Pillow 90.9/100 91% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:23.303Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:24.307Mcoup_de_grace
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(11), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:25.512Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(15), shadow_techniques(6), deeper_daggers, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:26.516Lrupture
[finish]
Fluffy_Pillow 90.9/100 91% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:27.521Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:27.521Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:27.521Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, tempered_potion
0:28.526Ksecret_technique
[finish]
Fluffy_Pillow 77.8/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.531Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(9), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:30.536Neviscerate
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:31.541Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:32.546Neviscerate
[finish]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:33.552Dshadowstrike
[build]
Fluffy_Pillow 83.1/100 83% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:34.556Dshadowstrike
[build]
Fluffy_Pillow 60.1/100 60% energy
5.0/7 71% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:35.562Neviscerate
[finish]
Fluffy_Pillow 45.2/100 45% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:36.568Ebackstab
[build]
Fluffy_Pillow 67.2/100 67% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:37.572Neviscerate
[finish]
Fluffy_Pillow 49.3/100 49% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:38.577Ebackstab
[build]
Fluffy_Pillow 71.3/100 71% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
0:39.580Ebackstab
[build]
Fluffy_Pillow 53.3/100 53% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:40.926Neviscerate
[finish]
Fluffy_Pillow 37.1/100 37% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
0:41.931Hsymbols_of_death
[cds]
Combo 1 47.9/100 48% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
0:41.931Qshadow_dance
[stealth_cds]
Combo 1 87.9/100 88% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:41.931Dshadowstrike
[build]
Fluffy_Pillow 87.9/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:42.936Neviscerate
[finish]
Fluffy_Pillow 61.7/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:43.941Dshadowstrike
[build]
Fluffy_Pillow 87.5/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:44.946Ksecret_technique
[finish]
Fluffy_Pillow 61.3/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:45.951Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(5), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:46.956Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:48.159Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:49.164Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:50.169Ebackstab
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:51.173Neviscerate
[finish]
Fluffy_Pillow 71.4/100 71% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:52.178Ebackstab
[build]
Fluffy_Pillow 77.2/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:53.183Ebackstab
[build]
Fluffy_Pillow 56.0/100 56% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:54.315Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:55.320Ebackstab
[build]
Fluffy_Pillow 42.0/100 42% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:57.478Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:59.392Lrupture
[finish]
Fluffy_Pillow 26.4/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:00.399Hsymbols_of_death
[cds]
Combo 1 47.8/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:00.399Qshadow_dance
[stealth_cds]
Combo 1 87.8/100 88% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:00.399Dshadowstrike
[build]
Fluffy_Pillow 87.8/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:01.404Ksecret_technique
[finish]
Fluffy_Pillow 62.2/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:02.410Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(3), shadow_techniques(8), the_rotten, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:03.415Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(4), bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:04.619Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:05.623Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:06.627Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:07.631Neviscerate
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:08.634Ebackstab
[build]
Fluffy_Pillow 87.6/100 88% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_haste
1:09.637Neviscerate
[finish]
Fluffy_Pillow 59.0/100 59% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), deeper_daggers, flask_of_alchemical_chaos_haste
1:10.642Ebackstab
[build]
Fluffy_Pillow 78.4/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:11.646Ebackstab
[build]
Fluffy_Pillow 49.8/100 50% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), deeper_daggers, flask_of_alchemical_chaos_haste
1:12.993Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
1:15.413Neviscerate
[finish]
Fluffy_Pillow 36.6/100 37% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
1:16.418Ebackstab
[build]
Fluffy_Pillow 52.0/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
1:18.205Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
1:19.208Ebackstab
[build]
Fluffy_Pillow 42.7/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
1:21.904Ebackstab
[build]
Fluffy_Pillow 45.3/100 45% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
1:24.316Mcoup_de_grace
[finish]
Fluffy_Pillow 36.7/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
1:25.520Ebackstab
[build]
Fluffy_Pillow 70.4/100 70% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
1:26.525Ebackstab
[build]
Fluffy_Pillow 45.8/100 46% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
1:29.287Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:30.293Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 16.6/100 17% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:30.898Jflagellation
[cds]
Fluffy_Pillow 23.4/100 23% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:32.009Hsymbols_of_death
[cds]
Combo 1 40.1/100 40% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), flagellation_buff, deeper_daggers, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:32.009Qshadow_dance
[stealth_cds]
Combo 1 80.1/100 80% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:32.009Ksecret_technique
[finish]
Fluffy_Pillow 80.1/100 80% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:33.014Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(10), poised_shadows, bolstering_shadows, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:34.019Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(6), the_rotten, flagellation_buff(10), bolstering_shadows, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:34.019Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(6), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:35.024Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(8), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:36.028Ishadow_blades
[cds]
Combo 1 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:36.029Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:37.036Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:38.040Neviscerate
[finish]
Fluffy_Pillow 60.3/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(8), flagellation_buff(27), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:39.045Neviscerate
[finish]
Fluffy_Pillow 79.7/100 80% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:40.049Ebackstab
[build]
Fluffy_Pillow 99.1/100 99% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:41.054Lrupture
[finish]
Fluffy_Pillow 78.5/100 78% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:42.058Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:43.062Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:43.062Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(2), flagellation_persist(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:44.066Fcold_blood
[cds]
Combo 1 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(4), flagellation_persist(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:44.066Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade(3), flawless_form(2), shadow_techniques(4), flagellation_persist(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:45.070Hsymbols_of_death
[cds]
Combo 1 98.8/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:45.070Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:46.076Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:47.279Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, flawless_form(7), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:48.284Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(10), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:49.289Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
1:50.294Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
1:51.299Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(9), flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
1:52.302Neviscerate
[finish]
Fluffy_Pillow 93.8/100 94% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
1:53.309Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
1:54.315Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
1:55.317Ebackstab
[build]
Fluffy_Pillow 98.8/100 99% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
1:56.321Ebackstab
[build]
Fluffy_Pillow 78.2/100 78% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
1:57.325Mcoup_de_grace
[finish]
Fluffy_Pillow 49.6/100 50% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(9), shadow_techniques, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
1:58.529Ebackstab
[build]
Fluffy_Pillow 96.2/100 96% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:59.534Ebackstab
[build]
Fluffy_Pillow 67.0/100 67% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
2:00.538Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
2:02.996Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
2:03.999Rvanish
[stealth_cds]
Combo 1 46.9/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
2:03.999Dshadowstrike
[build]
Fluffy_Pillow 46.9/100 47% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
2:05.487Lrupture
[finish]
Fluffy_Pillow 25.9/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
2:06.492Ebackstab
[build]
Fluffy_Pillow 46.7/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:08.960Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:09.963Hsymbols_of_death
[cds]
Combo 1 16.0/100 16% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:10.024Qshadow_dance
[stealth_cds]
Combo 1 56.7/100 57% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:10.024Ksecret_technique
[finish]
Fluffy_Pillow 56.7/100 57% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:11.029Dshadowstrike
[build]
Fluffy_Pillow 95.5/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(4), the_rotten(2), poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:12.034Mcoup_de_grace
[finish]
Fluffy_Pillow 69.3/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(6), the_rotten, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:13.240Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(10), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:14.245Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:15.249Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:16.253Neviscerate
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:17.256Dshadowstrike
[build]
Fluffy_Pillow 69.2/100 69% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(6), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:18.262Neviscerate
[finish]
Fluffy_Pillow 43.0/100 43% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:19.266Ebackstab
[build]
Fluffy_Pillow 61.8/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(6), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:20.272Neviscerate
[finish]
Fluffy_Pillow 40.7/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:21.277Ebackstab
[build]
Fluffy_Pillow 60.1/100 60% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:22.611Ebackstab
[build]
Fluffy_Pillow 43.1/100 43% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:24.723Ksecret_technique
[finish]
Fluffy_Pillow 30.9/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:25.728Ebackstab
[build]
Fluffy_Pillow 47.3/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:28.085Ebackstab
[build]
Fluffy_Pillow 41.9/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:30.662Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:31.865Ebackstab
[build]
Fluffy_Pillow 74.7/100 75% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:32.869Ebackstab
[build]
Fluffy_Pillow 46.6/100 47% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:35.448Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:37.119Lrupture
[finish]
Fluffy_Pillow 25.2/100 25% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:38.124Ebackstab
[build]
Fluffy_Pillow 46.2/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:40.786Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:43.375Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:45.607Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:46.612Ebackstab
[build]
Fluffy_Pillow 50.6/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, flawless_form, shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:48.999Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:51.562Neviscerate
[finish]
Fluffy_Pillow 38.4/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:52.567Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:54.664Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:57.483Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:58.488Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
3:00.101Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 22.9/100 23% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
3:01.392Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
3:02.397Jflagellation
[cds]
Fluffy_Pillow 16.3/100 16% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
3:03.401Hsymbols_of_death
[cds]
Combo 1 27.3/100 27% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(2), shadow_techniques, flagellation_buff, deeper_daggers, seabed_leviathans_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
3:03.401Qshadow_dance
[stealth_cds]
Combo 1 67.3/100 67% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
3:03.401Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 67.3/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
3:03.401Ksecret_technique
[finish]
Fluffy_Pillow 67.3/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:04.406Dshadowstrike
[build]
Fluffy_Pillow 96.5/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:05.412Mcoup_de_grace
[finish]
Fluffy_Pillow 70.7/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:06.616Ishadow_blades
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:06.616Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:07.620Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:08.623Neviscerate
[finish]
Fluffy_Pillow 85.7/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:09.626Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:10.629Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:11.633Ebackstab
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:12.638Lrupture
[finish]
Fluffy_Pillow 73.2/100 73% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(10), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:13.642Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:13.642Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:13.642Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:14.646Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:15.650Fcold_blood
[cds]
Combo 1 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:15.650Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:16.653Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:17.659Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(3), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:18.662Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:19.666Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:20.671Mcoup_de_grace
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:21.874Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:22.878Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
3:23.883Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
3:24.886Hsymbols_of_death
[cds]
Combo 1 90.8/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
3:25.024Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:25.024Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:26.030Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:27.034Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:28.038Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(3), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:29.043Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(5), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
3:30.047Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:31.052Dshadowstrike
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:32.055Neviscerate
[finish]
Fluffy_Pillow 76.2/100 76% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:33.059Ebackstab
[build]
Fluffy_Pillow 95.6/100 96% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:34.063Neviscerate
[finish]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:35.066Ebackstab
[build]
Fluffy_Pillow 94.4/100 94% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_haste
3:36.071Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:37.076Ebackstab
[build]
Fluffy_Pillow 96.2/100 96% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_haste
3:38.081Lrupture
[finish]
Fluffy_Pillow 75.6/100 76% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:39.084Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
3:40.088Ebackstab
[build]
Fluffy_Pillow 79.4/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:41.092Mcoup_de_grace
[finish]
Fluffy_Pillow 58.8/100 59% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
3:42.296Ebackstab
[build]
Fluffy_Pillow 97.5/100 97% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
3:43.300Ebackstab
[build]
Fluffy_Pillow 72.9/100 73% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:44.303Neviscerate
[finish]
Fluffy_Pillow 48.3/100 48% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:45.308Ebackstab
[build]
Fluffy_Pillow 54.7/100 55% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:47.292Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:50.108Hsymbols_of_death
[cds]
Combo 1 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:50.108Qshadow_dance
[stealth_cds]
Combo 1 81.2/100 81% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(6), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:50.108Ksecret_technique
[finish]
Fluffy_Pillow 81.2/100 81% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(6), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:51.113Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(7), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
3:52.118Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:53.121Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(8), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:54.125Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:55.129Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:56.134Neviscerate
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:57.139Dshadowstrike
[build]
Fluffy_Pillow 79.6/100 80% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_haste
3:58.144Neviscerate
[finish]
Fluffy_Pillow 54.0/100 54% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
3:59.149Ebackstab
[build]
Fluffy_Pillow 81.0/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(8), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:00.154Neviscerate
[finish]
Fluffy_Pillow 51.8/100 52% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:01.158Ebackstab
[build]
Fluffy_Pillow 70.7/100 71% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:02.162Ebackstab
[build]
Fluffy_Pillow 49.5/100 50% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:03.872Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:04.877Rvanish
[stealth_cds]
Combo 1 46.8/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:04.877Dshadowstrike
[build]
Fluffy_Pillow 46.8/100 47% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:06.755Ksecret_technique
[finish]
Fluffy_Pillow 30.1/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(5), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:07.759Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(4), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:09.281Lrupture
[finish]
Fluffy_Pillow 26.4/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:10.287Ebackstab
[build]
Fluffy_Pillow 42.2/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:13.146Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:16.113Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:18.618Mcoup_de_grace
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:19.822Ebackstab
[build]
Fluffy_Pillow 74.1/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:20.828Ebackstab
[build]
Fluffy_Pillow 49.0/100 49% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:22.935Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:23.939Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:26.544Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:29.336Neviscerate
[finish]
Fluffy_Pillow 36.6/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:30.340Ebackstab
[build]
Fluffy_Pillow 47.5/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:31.345Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 19.5/100 19% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:32.899Ebackstab
[build]
Fluffy_Pillow 41.9/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:33.904Jflagellation
[cds]
Fluffy_Pillow 17.7/100 18% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:34.909Hsymbols_of_death
[cds]
Combo 1 29.1/100 29% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(3), shadow_techniques, flagellation_buff, deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:34.909Qshadow_dance
[stealth_cds]
Combo 1 69.1/100 69% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:34.909Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 69.1/100 69% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:34.909Ksecret_technique
[finish]
Fluffy_Pillow 69.1/100 69% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:35.913Dshadowstrike
[build]
Fluffy_Pillow 98.6/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:36.918Ishadow_blades
[cds]
Combo 1 73.1/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(5), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:36.918Mcoup_de_grace
[finish]
Fluffy_Pillow 73.1/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(5), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:38.122Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(10), shadow_techniques(7), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:39.128Neviscerate
[finish]
Fluffy_Pillow 66.7/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(10), shadow_techniques(7), flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:40.132Neviscerate
[finish]
Fluffy_Pillow 86.5/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(10), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:41.137Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:42.141Neviscerate
[finish]
Fluffy_Pillow 66.7/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:43.145Ebackstab
[build]
Fluffy_Pillow 86.4/100 86% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:44.150Lrupture
[finish]
Fluffy_Pillow 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:45.153Hsymbols_of_death
[cds]
Combo 1 88.0/100 88% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade, flawless_form(8), shadow_techniques, flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:45.153Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques, the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:45.153Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:46.158Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), premeditation, shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:47.161Fcold_blood
[cds]
Combo 1 66.9/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:47.161Ksecret_technique
[finish]
Fluffy_Pillow 66.9/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:48.164Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:49.171Neviscerate
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:50.176Neviscerate
[finish]
Fluffy_Pillow 94.3/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:51.182Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:52.187Mcoup_de_grace
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:53.391Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
4:54.397Neviscerate
[finish]
Fluffy_Pillow 80.0/100 80% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
4:55.401Ebackstab
[build]
Fluffy_Pillow 91.9/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
4:56.404Ebackstab
[build]
Fluffy_Pillow 63.8/100 64% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
4:57.408Ebackstab
[build]
Fluffy_Pillow 51.8/100 52% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
4:58.721Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
4:59.725Ebackstab
[build]
Fluffy_Pillow 46.5/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:02.105Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:04.480Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:05.485Hsymbols_of_death
[cds]
Combo 1 47.5/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:05.485Qshadow_dance
[stealth_cds]
Combo 1 87.5/100 88% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:05.485Dshadowstrike
[build]
Fluffy_Pillow 87.5/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:06.490Ksecret_technique
[finish]
Fluffy_Pillow 61.9/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:07.494Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:08.499Neviscerate
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:09.504Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:10.509Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:11.514Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:12.520Mcoup_de_grace
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques, deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, storm_sewers_citrine
5:13.725Gpotion
[cds]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
5:13.725Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, tempered_potion
5:14.728Ebackstab
[build]
Fluffy_Pillow 71.2/100 71% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, tempered_potion
5:15.732Ebackstab
[build]
Fluffy_Pillow 50.4/100 50% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, tempered_potion
5:16.736Lrupture
[finish]
Fluffy_Pillow 29.6/100 30% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, tempered_potion
5:17.740Ebackstab
[build]
Fluffy_Pillow 50.9/100 51% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, tempered_potion
5:19.722Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, tempered_potion
5:22.552Neviscerate
[finish]
Fluffy_Pillow 40.6/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, tempered_potion
5:23.556Ebackstab
[build]
Fluffy_Pillow 51.8/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, tempered_potion
5:25.842Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, tempered_potion
5:28.558Ebackstab
[build]
Fluffy_Pillow 43.7/100 44% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(3), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers, tempered_potion
5:30.040Hsymbols_of_death
[cds]
Combo 1 24.3/100 24% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:30.040Qshadow_dance
[stealth_cds]
Combo 1 64.3/100 64% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:30.040Ksecret_technique
[finish]
Fluffy_Pillow 64.3/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:31.045Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(5), the_rotten(2), poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:32.050Neviscerate
[finish]
Fluffy_Pillow 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:33.053Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(7), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:34.055Mcoup_de_grace
[finish]
Fluffy_Pillow 74.2/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:35.260Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:36.264Neviscerate
[finish]
Fluffy_Pillow 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:37.268Dshadowstrike
[build]
Fluffy_Pillow 77.4/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:38.272Neviscerate
[finish]
Fluffy_Pillow 51.6/100 52% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:39.276Ebackstab
[build]
Fluffy_Pillow 65.9/100 66% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers, tempered_potion
5:40.668Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste2.79%2.79%1843
Versatility24.83%22.21%17321
Attack Power6162857457938
Mastery78.39%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 1"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 2 : 1,477,204 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,477,203.81,477,203.82,758.7 / 0.187%200,345.8 / 13.6%49,535.3
Resource Out In Waiting APM Active
Energy29.829.611.81%57.0100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 21,477,204
Auto Attack 0 (69,258)0.0% (4.7%)3.9122.34s5,288,3220

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,2393.1%353.40.99s39,27439,956Direct353.438,26877,09339,27418.8%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage353.39353.390.000.000.000.98290.000013,879,082.0918,109,639.8523.36%39,955.6739,955.67
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.85%229.1815830438,267.7823,22963,36238,282.6836,54940,2698,770,04211,443,55623.36%
crit18.75%66.283310677,092.5648,521126,89577,133.2469,34485,8815,109,0406,666,08423.36%
miss16.39%57.9435850.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,0181.6%352.40.99s19,60419,879Direct352.419,06738,46219,60618.9%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage352.39352.390.000.000.000.98620.00006,908,247.219,013,520.8523.36%19,878.8219,878.82
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.74%228.1415930319,066.9211,67031,63419,074.0617,98820,0604,349,9645,676,20423.36%
crit18.88%66.523810938,462.0723,58763,18838,481.5934,85042,9242,558,2833,337,31623.34%
miss16.38%57.7333870.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 29,9822.0%75.33.70s119,754119,218Direct75.372,788188,358119,72240.6%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.3375.330.000.000.001.00450.00009,021,448.9611,803,753.8523.57%119,217.79119,217.79
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit59.37%44.72267272,787.8257,139164,59472,798.3068,74677,9813,255,2094,261,50923.60%
crit40.63%30.611349188,357.59125,912391,319188,419.07172,564207,3135,766,2407,542,24523.56%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.34

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 87,872 (125,369)5.9% (8.5%)13.322.65s2,835,6082,354,255Direct39.7 (77.8)512,7991,039,291663,73828.7% (28.7%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2539.700.000.000.001.20450.000026,339,161.9634,294,746.3423.20%2,354,254.922,354,254.92
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.35%28.321441512,799.21118,5322,031,280513,215.96339,343740,82314,522,68318,908,92923.20%
crit28.65%11.373221,039,291.09239,8463,802,5901,041,340.09510,8571,911,25711,816,47915,385,81823.21%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.25
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 37,4982.5%0.00.00s00Direct38.1228,296460,216294,84528.7%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.120.000.000.000.00000.000011,241,809.4011,241,809.400.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.27%27.171543228,296.4256,509816,205228,720.08155,568309,6956,204,3706,204,3700.00%
crit28.73%10.95221460,215.82114,3451,765,127460,261.95193,336713,2055,037,4395,037,4390.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,064)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,0641.4%22.412.95s268,7520Direct22.4268,9190268,9190.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.4222.410.000.000.000.00000.00006,025,972.516,025,972.510.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.411242268,918.95260,578311,151268,877.60261,981278,4106,025,9736,025,9730.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 251,496 (359,889)17.0% (24.3%)68.44.38s1,577,1471,570,104Direct68.4 (135.5)851,3531,738,5941,102,41128.3% (28.4%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.4268.420.000.000.001.00450.000075,406,352.3098,092,179.8723.13%1,570,103.741,570,103.74
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.70%49.063270851,353.26210,8622,419,491850,871.51708,739993,52541,751,22454,315,29123.13%
crit28.30%19.368331,738,593.90422,3574,924,3291,738,945.531,135,0082,473,23333,655,12843,776,88923.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.43

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 108,3927.3%67.14.46s484,2960Direct67.1374,508760,775484,42128.5%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.1267.120.000.000.000.00000.000032,505,307.4532,505,307.450.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.52%48.003166374,507.88100,5271,066,575374,487.44317,904448,86917,975,18117,975,1810.00%
crit28.48%19.11731760,775.08201,3562,052,311760,878.41491,7411,049,70514,530,12614,530,1260.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,023 (20,879)0.1% (1.4%)3.791.35s1,688,9481,681,496Direct3.7 (27.6)69,505139,28782,49918.6% (19.5%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000306,259.14306,259.140.00%1,681,496.281,681,496.28
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.40%3.020469,505.2660,925139,09769,319.290108,289210,054210,0540.00%
crit18.60%0.6903139,286.86122,033264,74174,754.790264,74196,20596,2050.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 19,8561.3%0.00.00s00Direct23.9208,837418,269249,93419.7%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.860.000.000.000.00000.00005,964,040.495,964,040.490.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.35%19.171026208,837.1877,405452,357208,769.14168,014239,1204,003,8064,003,8060.00%
crit19.65%4.69013418,268.68167,446862,952414,234.580817,2211,960,2351,960,2350.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,0420.8%0.00.00s00Direct282.010,75421,69012,81318.8%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00282.040.000.000.000.00000.00003,613,646.523,613,646.520.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.17%228.9315430910,753.727,51417,29510,756.7810,27411,3112,461,7002,461,7000.00%
crit18.83%53.11228621,689.6715,05134,63721,698.9318,73424,7741,151,9471,151,9470.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Phantom Reaping 20,173 (23,545)1.4% (1.6%)19.015.49s372,9640Direct19.0 (31.9)267,836537,110319,45619.2% (19.0%)0.0%

Stats Details: Phantom Reaping

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage18.9518.950.000.000.000.00000.00006,054,981.096,054,981.090.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.82%15.32533267,835.60259,030308,498267,774.19259,030278,3024,102,3234,102,3230.00%
crit19.18%3.64011537,109.92518,836619,534523,320.280599,5971,952,6591,952,6590.00%

Action Details: Phantom Reaping

  • id:448669
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:201465.44
  • base_dd_max:201465.44
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:448669
  • name:Phantom Reaping
  • school:shadow
  • tooltip:
  • description:{$@spelldesc444067=Your abilities have a high chance to summon a phantom ethereal, dealing {$=}{{$=}<rolemult>*{$s1=67342}} Shadow damage to your target and {$=}{{$=}<rolemult>*{$s1=67342}*({$s5=9}/100)} Shadow damage to all other enemies caught in its path. If the target is below {$s2=35}% health, this effect summons two additional phantoms at {$s3=25}% effectiveness.}
    Phantom Reaping (Echo) 3,3720.2%12.96.75s78,5000Direct12.966,140132,46978,51218.6%0.0%

Stats Details: Phantom Reaping Echo

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage12.9112.910.000.000.000.00000.00001,013,756.201,013,756.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.36%10.5122766,139.6264,75772,66066,117.3964,75769,904694,942694,9420.00%
crit18.64%2.41010132,468.66129,708145,411119,455.980143,587318,814318,8140.00%

Action Details: Phantom Reaping Echo

  • id:448669
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:50366.36
  • base_dd_max:50366.36
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:448669
  • name:Phantom Reaping
  • school:shadow
  • tooltip:
  • description:{$@spelldesc444067=Your abilities have a high chance to summon a phantom ethereal, dealing {$=}{{$=}<rolemult>*{$s1=67342}} Shadow damage to your target and {$=}{{$=}<rolemult>*{$s1=67342}*({$s5=9}/100)} Shadow damage to all other enemies caught in its path. If the target is below {$s2=35}% health, this effect summons two additional phantoms at {$s3=25}% effectiveness.}
Rupture 96,960 (114,774)6.6% (7.8%)9.631.24s3,602,5093,586,461Periodic166.8 (333.7)134,289278,507174,46927.9% (27.7%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.560.00166.83166.837.071.00451.748929,098,936.5829,098,936.580.00%114,293.013,586,460.85
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.14%120.3586161134,289.37135420,568134,359.11119,753152,34516,157,95016,157,9500.00%
crit27.86%46.492273278,507.26267846,114278,632.39209,306356,46012,940,98712,940,9870.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.56
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 17,8151.2%166.81.77s32,0410Periodic166.824,69451,31932,04927.6%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage166.830.000.00166.830.000.00000.00005,345,433.415,345,433.410.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.37%120.748015924,693.999,67177,11624,701.0721,69227,2992,980,8432,980,8430.00%
crit27.63%46.09207551,319.3619,371155,14451,391.3238,08665,3832,364,5912,364,5910.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (268,661)0.0% (18.2%)16.019.00s5,024,3745,002,180

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.040.000.000.000.001.00450.00000.000.000.00%5,002,179.915,002,179.91

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.04
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 68,9994.7%0.00.00s00Direct16.0675,7442,104,7071,290,77543.0%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.040.000.000.000.00000.000020,700,940.9926,990,236.7823.30%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.99%9.14315675,744.06150,6161,560,651676,403.33458,834970,3096,176,1228,073,78823.50%
crit43.01%6.903132,104,707.38302,5984,058,0602,142,494.411,235,0633,148,29914,524,81918,916,44923.21%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 199,66213.5%0.00.00s00Direct32.0986,7473,006,5211,874,05243.9%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.970.000.000.000.00000.000059,899,183.8759,899,183.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.08%17.93928986,746.80222,2922,258,883989,428.84704,5651,294,04817,697,11117,697,1110.00%
crit43.92%14.047233,006,520.77445,2515,868,4373,030,746.172,129,0424,312,45442,202,07342,202,0730.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (103,236)0.0% (7.0%)3.690.90s8,511,8310

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.640.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.64
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 103,2367.0%384.01.20s80,7070Periodic384.080,717080,7170.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage384.010.000.00384.010.000.00000.000030,992,126.8030,992,126.800.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%384.0129246980,717.361391,116,83880,738.5367,54396,42430,992,12730,992,1270.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3467.60
  • base_dd_max:3467.60
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,0437.9%52.35.86s670,077667,076Direct52.3279,967913,176670,20861.6%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.3252.320.000.000.001.00450.000035,057,524.1345,718,418.5223.32%667,076.23667,076.23
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.37%20.08931279,966.93130,261407,405279,901.48249,306319,3505,619,8247,321,69023.25%
crit61.63%32.242145913,175.61287,0431,392,481913,953.82818,363993,52829,437,70038,396,72823.33%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.31

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,5630.2%2.365.35s471,0900Direct2.3398,069802,219470,91818.1%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.272.270.000.000.000.00000.00001,067,205.801,067,205.800.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.91%1.8607398,068.86377,346480,572334,434.630468,656738,505738,5050.00%
crit18.09%0.4103802,219.41755,824982,118280,627.360982,118328,701328,7010.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8340.1%2.369.39s107,3780Direct2.390,493181,450107,42318.6%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.342.340.000.000.000.00000.0000250,930.31250,930.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.42%1.900890,493.0183,958119,92876,619.330111,725172,168172,1680.00%
crit18.58%0.4303181,449.79168,168227,66764,018.150227,66778,76278,7620.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:65300.15
  • base_dd_max:65300.15
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 46,9123.2%19.114.78s739,9510Periodic107.2131,6230131,6230.0%0.0%71.4%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.060.00107.22107.2212.140.00002.000014,103,526.4914,103,526.490.00%65,768.800.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.2256154131,623.2360,995218,384130,491.4173,747179,37614,103,52614,103,5260.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 72,3974.9%37.17.91s586,4550Direct37.1493,235989,745586,47618.8%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage37.0737.070.000.000.000.00000.000021,740,298.0721,740,298.070.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.22%30.111351493,235.44453,001841,420492,814.01461,132542,89214,850,18114,850,1810.00%
crit18.78%6.96016989,745.26907,3601,655,340988,857.2701,305,5726,890,1176,890,1170.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,3510.3%2.365.59s567,5120Direct2.3477,385956,985567,38818.8%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.302.300.000.000.000.00000.00001,307,219.411,307,219.410.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.21%1.8708477,384.51452,539573,997410,102.110554,593893,086893,0860.00%
crit18.79%0.4304956,985.41906,4361,185,178325,912.5901,185,178414,134414,1340.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 84,4045.7%58.15.21s436,3220Direct58.1366,512737,264436,38418.8%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.0558.050.000.000.000.00000.000025,328,592.1633,089,987.6223.46%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.16%47.113065366,511.89220,828558,471366,681.19337,830405,37617,264,96422,557,30323.46%
crit18.84%10.94224737,264.09442,3191,118,572737,581.64561,6671,020,8098,063,62910,532,68523.45%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 2
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.96s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.04s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.411.57s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.450.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.374.66s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.330.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.370.35s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.350.0068.760.000.350.00000.83460.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5307.58s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 99.03.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.960.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.371.28s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.340.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.25s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.30
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.369.39s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.342.340.000.000.000.00000.00000.001,590,249.960.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.34090.00000.000001,590,25089.96%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8340.1%2.369.39s107,3780Direct2.390,493181,450107,42318.6%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.342.340.000.000.000.00000.0000250,930.31250,930.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.42%1.900890,493.0183,958119,92876,619.330111,725172,168172,1680.00%
crit18.58%0.4303181,449.79168,168227,66764,018.150227,66778,76278,7620.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:65300.15
  • base_dd_max:65300.15
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.41s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.29
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.34s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.477.55s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.380.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1589.0159.5s0.5s275.3s99.94%100.00%579.2 (579.2)0.1

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:14.7s / 338.2s
  • trigger_min/max:0.0s / 4.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 359.9s
  • uptime_min/max:99.24% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.15%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.16%
  • acrobatic_strikes_10:98.32%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.4118.8s3.5s125.7s97.31%0.00%73.9 (76.7)1.3

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 342.5s
  • trigger_min/max:1.0s / 36.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.8s
  • uptime_min/max:87.79% / 99.44%

Stack Uptimes

  • alacrity_1:3.05%
  • alacrity_2:2.27%
  • alacrity_3:1.83%
  • alacrity_4:1.67%
  • alacrity_5:88.48%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.50%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.64%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.019.0s19.0s6.9s36.99%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 57.4s
  • trigger_min/max:9.2s / 57.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.62% / 40.14%

Stack Uptimes

  • bolstering_shadows_1:36.99%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.1s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.0s / 182.4s
  • trigger_min/max:83.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.08%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0134.6s117.9s4.4s1.86%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 276.3s
  • trigger_min/max:90.0s / 187.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.4s
  • uptime_min/max:0.00% / 6.63%

Stack Uptimes

  • cryptic_instructions_1:1.86%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.348.023.2s23.2s8.2s36.38%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 72.5s
  • trigger_min/max:8.0s / 72.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.09% / 38.95%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.56%
  • danse_macabre_4:16.46%
  • danse_macabre_5:8.78%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.140.7s3.7s35.5s89.85%95.57%74.1 (74.1)6.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 169.0s
  • trigger_min/max:1.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 152.9s
  • uptime_min/max:79.70% / 96.33%

Stack Uptimes

  • deeper_daggers_1:89.85%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.019.0s19.0s3.4s18.40%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 57.4s
  • trigger_min/max:9.2s / 57.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.38% / 21.10%

Stack Uptimes

  • disorienting_strikes_1:12.21%
  • disorienting_strikes_2:6.19%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0128.7s111.4s4.0s1.64%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.0s
  • trigger_min/max:90.0s / 198.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.6s
  • uptime_min/max:0.00% / 6.31%

Stack Uptimes

  • errant_manaforge_emission_1:1.64%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.022.1s5.2s17.4s81.73%0.00%3.2 (3.2)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 63.0s
  • trigger_min/max:1.0s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 61.8s
  • uptime_min/max:65.91% / 92.54%

Stack Uptimes

  • escalating_blade_1:25.09%
  • escalating_blade_2:22.14%
  • escalating_blade_3:22.43%
  • escalating_blade_4:12.07%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.6s90.6s14.7s18.18%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:83.6s / 183.1s
  • trigger_min/max:83.6s / 183.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:13.15% / 20.80%

Stack Uptimes

  • ethereal_powerlink_1:18.18%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.284.2s70.9s15.4s10.67%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4399.55

Trigger Details

  • interval_min/max:15.0s / 319.6s
  • trigger_min/max:1.0s / 319.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.6s
  • uptime_min/max:0.00% / 38.68%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.67%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.64%0.00%14.3 (96.1)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.4s
  • trigger_min/max:1.0s / 88.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.93% / 16.92%

Stack Uptimes

  • flagellation_buff_1:1.32%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.76%
  • flagellation_buff_9:0.61%
  • flagellation_buff_10:0.55%
  • flagellation_buff_11:0.47%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.03%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.69%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.43%
  • flagellation_buff_20:0.39%
  • flagellation_buff_21:0.32%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.20%
  • flagellation_buff_25:0.84%
  • flagellation_buff_26:0.36%
  • flagellation_buff_27:0.19%
  • flagellation_buff_28:0.22%
  • flagellation_buff_29:0.00%
  • flagellation_buff_30:7.10%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.9s14.24%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.2s / 98.4s
  • trigger_min/max:78.2s / 98.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.31% / 16.23%

Stack Uptimes

  • flagellation_persist_23:0.00%
  • flagellation_persist_30:14.23%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6111.4s77.2s34.7s24.61%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 341.8s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 78.56%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.61%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.7111.1s75.5s35.7s25.48%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 68.93%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.48%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6113.5s78.8s35.3s24.39%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 156.7s
  • uptime_min/max:0.00% / 79.58%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.39%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.20.6109.9s74.9s35.6s25.52%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 331.6s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 180.0s
  • uptime_min/max:0.00% / 81.36%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.52%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.30.039.3s3.4s58.7s95.41%100.00%0.0 (0.0)3.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.78%
  • flawless_form_2:8.91%
  • flawless_form_3:11.78%
  • flawless_form_4:9.66%
  • flawless_form_5:2.68%
  • flawless_form_6:4.47%
  • flawless_form_7:5.91%
  • flawless_form_8:11.27%
  • flawless_form_9:18.57%
  • flawless_form_10:8.67%
  • flawless_form_11:1.37%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.15%
  • flawless_form_16:0.10%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Poised Shadows13.90.422.0s21.3s3.7s17.02%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 85.0s
  • trigger_min/max:1.0s / 67.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:8.90% / 27.21%

Stack Uptimes

  • poised_shadows_1:17.02%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.61%11.21%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 64.5s
  • trigger_min/max:1.0s / 64.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.4s
  • uptime_min/max:0.77% / 4.98%

Stack Uptimes

  • premeditation_1:2.61%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0131.1s112.5s4.0s1.62%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 313.3s
  • trigger_min/max:90.0s / 187.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.6s
  • uptime_min/max:0.00% / 7.34%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.62%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.00.285.3s72.4s15.3s10.42%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23922.58

Trigger Details

  • interval_min/max:15.2s / 345.5s
  • trigger_min/max:0.9s / 345.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 48.2s
  • uptime_min/max:0.00% / 36.56%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.42%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.60.090.8s90.8s15.8s19.19%17.20%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.3s
  • trigger_min/max:90.0s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 16.0s
  • uptime_min/max:16.77% / 21.89%

Stack Uptimes

  • shadow_blades_1:19.19%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.2s23.2s8.2s36.38%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 72.5s
  • trigger_min/max:8.0s / 72.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.09% / 38.95%

Stack Uptimes

  • shadow_dance_1:36.38%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.1137.74.4s1.5s3.5s79.09%95.45%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 43.4s
  • trigger_min/max:0.5s / 7.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.1s
  • uptime_min/max:71.90% / 87.04%

Stack Uptimes

  • shadow_techniques_1:20.45%
  • shadow_techniques_2:21.02%
  • shadow_techniques_3:9.39%
  • shadow_techniques_4:10.48%
  • shadow_techniques_5:6.06%
  • shadow_techniques_6:5.79%
  • shadow_techniques_7:2.57%
  • shadow_techniques_8:2.31%
  • shadow_techniques_9:0.51%
  • shadow_techniques_10:0.45%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s298.3s99.32%86.12%99.0 (99.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.3s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.40.0115.0s100.4s9.9s1.29%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.1s / 275.8s
  • trigger_min/max:1.0s / 270.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.2s
  • uptime_min/max:0.00% / 11.42%

Stack Uptimes

  • storm_sewers_citrine_1:1.29%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0114.7s102.1s9.9s1.29%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.8s / 329.2s
  • trigger_min/max:3.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:1.8s / 18.0s
  • uptime_min/max:0.00% / 11.27%

Stack Uptimes

  • storm_sewers_citrine_1:1.29%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0112.5s105.5s9.9s1.43%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.0s / 282.9s
  • trigger_min/max:1.0s / 282.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 17.0s
  • uptime_min/max:0.00% / 14.92%

Stack Uptimes

  • storm_sewers_citrine_1:1.43%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.095.4s92.1s9.9s1.33%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:3.0s / 291.2s
  • trigger_min/max:2.1s / 291.2s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 17.0s
  • uptime_min/max:0.00% / 13.45%

Stack Uptimes

  • storm_sewers_citrine_1:1.33%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0109.8s104.9s9.9s1.22%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.2s / 312.8s
  • trigger_min/max:2.5s / 312.8s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 17.0s
  • uptime_min/max:0.00% / 10.99%

Stack Uptimes

  • storm_sewers_citrine_1:1.22%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.282.6s70.8s15.3s10.61%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1468.42
  • stat:haste_rating
  • amount:1468.42
  • stat:mastery_rating
  • amount:1468.42
  • stat:versatility_rating
  • amount:1468.42

Trigger Details

  • interval_min/max:15.1s / 300.3s
  • trigger_min/max:0.3s / 300.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.5s
  • uptime_min/max:0.00% / 38.10%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.61%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.3s21.3s2.3s10.94%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 67.5s
  • trigger_min/max:3.0s / 67.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.6s
  • uptime_min/max:9.14% / 14.23%

Stack Uptimes

  • supercharge_1_1:10.94%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.01%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 67.5s
  • trigger_min/max:1.0s / 67.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.4s
  • uptime_min/max:0.59% / 5.88%

Stack Uptimes

  • supercharge_2_1:2.01%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s0.7s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 1.0s
  • uptime_min/max:0.00% / 0.34%

Stack Uptimes

  • supercharge_3_1:0.00%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.5s21.3s24.5s61.11%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.0s / 96.7s
  • trigger_min/max:1.0s / 67.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:57.97% / 65.06%

Stack Uptimes

  • symbols_of_death_1:61.11%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.9s307.9s27.4s13.34%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.1s
  • trigger_min/max:300.0s / 329.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.96% / 18.12%

Stack Uptimes

  • tempered_potion_1:13.34%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.80%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.3s21.3s2.9s13.82%22.31%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 67.5s
  • trigger_min/max:1.0s / 67.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.2s
  • uptime_min/max:11.37% / 16.92%

Stack Uptimes

  • the_rotten_1:10.74%
  • the_rotten_2:3.08%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.2s
  • trigger_min/max:120.0s / 136.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.43%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.00.0s6.0s15.7s0.30%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4803.19

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:1.0s / 12.4s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 27.4s
  • uptime_min/max:0.00% / 10.79%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.33%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.10.282.0s69.9s15.4s10.75%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5499.44

Trigger Details

  • interval_min/max:15.1s / 306.8s
  • trigger_min/max:0.3s / 306.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 42.7s
  • uptime_min/max:0.00% / 36.11%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.75%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.426.082.06.0s0.7s64.5s
Skyfury (Off Hand)48.923.076.06.1s0.7s67.1s
Supercharger secret_technique12.58.017.023.6s9.2s89.7s
Cold Blood secret_technique3.63.04.090.7s83.0s182.4s
Supercharger rupture0.30.02.0192.3s46.9s282.0s
Supercharger coup_de_grace2.80.08.076.0s8.8s318.1s
Supercharger eviscerate13.06.020.023.2s1.0s165.4s
CP Spent During Flagellation202.2136.0248.011.2s1.0s89.4s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.24%6.08%13.97%0.7s0.0s2.4s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 2
Energy RegenEnergy1,451.963,032.0034.10%2.09390.6011.41%
Improved AmbushCombo Points52.3133.504.58%0.6418.8135.96%
PremeditationCombo Points17.2157.017.80%3.3163.4552.67%
Relentless StrikesEnergy107.284,268.6948.01%39.79123.812.82%
Shadow BladesCombo Points21.97114.1715.62%5.2017.6713.40%
Shadow TechniquesEnergy358.401,231.8313.85%3.44201.7814.08%
Shadow TechniquesCombo Points85.42239.9632.83%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.24106.6514.59%7.000.000.00%
BackstabCombo Points75.3474.9210.25%0.990.410.55%
ShadowstrikeCombo Points52.31104.6014.31%2.000.020.02%
Symbols of DeathEnergy14.29359.254.04%25.14212.3937.15%
Usage Type Count Total Tot% Avg RPE APR
Combo 2
BackstabEnergy75.343,013.4133.68%40.0040.002,993.76
Coup de GraceEnergy13.25463.895.19%35.0035.0081,012.95
Coup de GraceCombo Points13.2590.4812.45%6.836.83415,351.00
EviscerateEnergy68.432,394.9526.77%35.0035.0045,057.91
EviscerateCombo Points68.43466.1764.13%6.816.81231,488.10
RuptureEnergy9.56239.042.67%25.0025.00144,097.35
RuptureCombo Points9.5665.338.99%6.836.83527,236.10
Secret TechniqueEnergy16.04481.245.38%30.0030.00167,483.07
Secret TechniqueCombo Points16.04104.8914.43%6.546.54768,441.98
ShadowstrikeEnergy52.312,354.1126.31%45.0045.0014,892.07
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6029.79928.645.20.4100.0
Combo Points0.02.432.42100.34.00.07.0

Statistics & Data Analysis

Fight Length
Combo 2 Fight Length
Count 1315
Mean 300.36
Minimum 240.36
Maximum 359.90
Spread ( max - min ) 119.55
Range [ ( max - min ) / 2 * 100% ] 19.90%
DPS
Combo 2 Damage Per Second
Count 1315
Mean 1477203.80
Minimum 1327745.79
Maximum 1633081.03
Spread ( max - min ) 305335.24
Range [ ( max - min ) / 2 * 100% ] 10.33%
Standard Deviation 51040.3980
5th Percentile 1391072.28
95th Percentile 1560028.54
( 95th Percentile - 5th Percentile ) 168956.26
Mean Distribution
Standard Deviation 1407.5090
95.00% Confidence Interval ( 1474445.13 - 1479962.47 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4587
0.1 Scale Factor Error with Delta=300 22238822
0.05 Scale Factor Error with Delta=300 88955287
0.01 Scale Factor Error with Delta=300 2223882168
Priority Target DPS
Combo 2 Priority Target Damage Per Second
Count 1315
Mean 1477203.80
Minimum 1327745.79
Maximum 1633081.03
Spread ( max - min ) 305335.24
Range [ ( max - min ) / 2 * 100% ] 10.33%
Standard Deviation 51040.3980
5th Percentile 1391072.28
95th Percentile 1560028.54
( 95th Percentile - 5th Percentile ) 168956.26
Mean Distribution
Standard Deviation 1407.5090
95.00% Confidence Interval ( 1474445.13 - 1479962.47 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4587
0.1 Scale Factor Error with Delta=300 22238822
0.05 Scale Factor Error with Delta=300 88955287
0.01 Scale Factor Error with Delta=300 2223882168
DPS(e)
Combo 2 Damage Per Second (Effective)
Count 1315
Mean 1477203.80
Minimum 1327745.79
Maximum 1633081.03
Spread ( max - min ) 305335.24
Range [ ( max - min ) / 2 * 100% ] 10.33%
Damage
Combo 2 Damage
Count 1315
Mean 443171983.34
Minimum 349428557.15
Maximum 535434325.83
Spread ( max - min ) 186005768.68
Range [ ( max - min ) / 2 * 100% ] 20.99%
DTPS
Combo 2 Damage Taken Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 2 Healing Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 2 Healing Per Second (Effective)
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 2 Heal
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 2 Healing Taken Per Second
Count 1315
Mean 3006.56
Minimum 0.00
Maximum 9898.36
Spread ( max - min ) 9898.36
Range [ ( max - min ) / 2 * 100% ] 164.61%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.31 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.34 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.29 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.64 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.04 secret_technique,if=variable.secret
L 9.56 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.25 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.43 eviscerate
actions.item
# count action,conditions
O 3.73 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.71 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.30 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

025ODGJNRDLHQPDIKNDNDNNDHNNDQFKDMNDNNDNHQDNDKNDNDELEEMEENHQDNDKDNDDNENEELEENEEKEEEMEEENEOEJLHQPDNDIKDMDNNEHQNDNFKDNDMNENENHELEQKDNDNDNDMRDNHENENEENENEEKENEEELEEEMEENEEENEOEJHQKPDNDIMDNDLNHQDFKDNNDNDNENNEHQKDMDNDNDNEENELEENEEHQKDNDMDNDNENEEELEEENRDNENEENEOEJHQPKDIMDNNDNELHQNDFKDMNDNENEENEENEHQKDMNDDNDGLEENEENEEKEHNEMQDNDNDNDNE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.005Gpotion
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence
0:01.005Jflagellation
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.010Neviscerate
[finish]
Fluffy_Pillow 86.4/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(6), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.014Rvanish
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(8), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.014Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(8), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.020Lrupture
[finish]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Hsymbols_of_death
[cds]
Combo 2 97.3/100 97% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ishadow_blades
[cds]
Combo 2 85.2/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(7), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ksecret_technique
[finish]
Fluffy_Pillow 85.2/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(7), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.031Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(2), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.037Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes(2), flawless_form(2), shadow_techniques(2), the_rotten, flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.043Neviscerate
[finish]
Fluffy_Pillow 77.5/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.048Dshadowstrike
[build]
Fluffy_Pillow 92.2/100 92% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.052Neviscerate
[finish]
Fluffy_Pillow 77.8/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:12.056Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:13.060Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.065Hsymbols_of_death
[cds]
Combo 2 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(7), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.065Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:15.070Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.073Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.077Qshadow_dance
[stealth_cds]
Combo 2 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.077Fcold_blood
[cds]
Combo 2 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), premeditation, shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.077Ksecret_technique
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(4), premeditation, shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:18.082Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(4), premeditation, shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:19.087Mcoup_de_grace
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(5), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:20.292Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:21.295Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:22.300Neviscerate
[finish]
Fluffy_Pillow 85.6/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:23.305Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:24.307Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
0:25.313Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
0:26.318Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
0:26.318Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:26.318Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), premeditation, shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:27.323Neviscerate
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:28.329Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:29.334Ksecret_technique
[finish]
Fluffy_Pillow 85.6/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(8), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:30.339Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:31.344Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:32.348Neviscerate
[finish]
Fluffy_Pillow 77.0/100 77% energy
6.0/7 86% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:33.353Dshadowstrike
[build]
Fluffy_Pillow 86.1/100 86% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:34.357Ebackstab
[build]
Fluffy_Pillow 63.1/100 63% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:35.362Lrupture
[finish]
Fluffy_Pillow 53.1/100 53% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:36.367Ebackstab
[build]
Fluffy_Pillow 77.2/100 77% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
0:37.372Ebackstab
[build]
Fluffy_Pillow 67.2/100 67% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
0:38.375Mcoup_de_grace
[finish]
Fluffy_Pillow 41.2/100 41% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:39.577Ebackstab
[build]
Fluffy_Pillow 91.0/100 91% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
0:40.581Ebackstab
[build]
Fluffy_Pillow 63.2/100 63% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_crit
0:41.587Neviscerate
[finish]
Fluffy_Pillow 42.0/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:42.591Hsymbols_of_death
[cds]
Combo 2 47.8/100 48% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:42.591Qshadow_dance
[stealth_cds]
Combo 2 87.8/100 88% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:42.591Dshadowstrike
[build]
Fluffy_Pillow 87.8/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:43.594Neviscerate
[finish]
Fluffy_Pillow 61.5/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:44.599Dshadowstrike
[build]
Fluffy_Pillow 87.3/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:45.604Ksecret_technique
[finish]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:46.609Dshadowstrike
[build]
Fluffy_Pillow 99.9/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
0:47.613Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:48.616Dshadowstrike
[build]
Fluffy_Pillow 84.5/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:49.621Dshadowstrike
[build]
Fluffy_Pillow 58.3/100 58% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:51.019Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:52.024Ebackstab
[build]
Fluffy_Pillow 55.1/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:53.709Neviscerate
[finish]
Fluffy_Pillow 41.2/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:54.713Ebackstab
[build]
Fluffy_Pillow 60.0/100 60% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
0:56.313Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:58.467Lrupture
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
0:59.471Ebackstab
[build]
Fluffy_Pillow 61.2/100 61% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
1:01.314Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), deeper_daggers, flask_of_alchemical_chaos_crit
1:03.848Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), flask_of_alchemical_chaos_crit
1:04.852Ebackstab
[build]
Fluffy_Pillow 42.0/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:07.759Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:09.931Ksecret_technique
[finish]
Fluffy_Pillow 32.6/100 33% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:10.936Ebackstab
[build]
Fluffy_Pillow 48.4/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:13.613Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:16.595Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:19.479Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(4), shadow_techniques, flask_of_alchemical_chaos_haste
1:20.684Ebackstab
[build]
Fluffy_Pillow 78.7/100 79% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:21.688Ebackstab
[build]
Fluffy_Pillow 49.8/100 50% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_haste
1:24.183Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:26.989Neviscerate
[finish]
Fluffy_Pillow 40.2/100 40% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:27.993Ebackstab
[build]
Fluffy_Pillow 50.3/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
1:29.966Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 36.1/100 36% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(8), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:30.336Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(8), shadow_techniques, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
1:31.339Jflagellation
[cds]
Fluffy_Pillow 11.2/100 11% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(8), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
1:32.344Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(3), shadow_techniques, flagellation_buff, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
1:33.349Hsymbols_of_death
[cds]
Combo 2 46.4/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(2), shadow_techniques(2), flagellation_buff(7), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
1:33.349Qshadow_dance
[stealth_cds]
Combo 2 86.4/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques(2), the_rotten(2), flagellation_buff(7), deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
1:33.349Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 86.4/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(7), deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
1:33.349Dshadowstrike
[build]
Fluffy_Pillow 86.4/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(7), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:34.351Neviscerate
[finish]
Fluffy_Pillow 60.5/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(7), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:35.356Dshadowstrike
[build]
Fluffy_Pillow 94.7/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(17), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.361Ishadow_blades
[cds]
Combo 2 68.9/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(4), flagellation_buff(17), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.361Ksecret_technique
[finish]
Fluffy_Pillow 68.9/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(4), flagellation_buff(17), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:37.364Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(6), flagellation_buff(27), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:38.369Mcoup_de_grace
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(6), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:39.574Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:40.579Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:41.586Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:42.590Ebackstab
[build]
Fluffy_Pillow 97.3/100 97% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:43.594Hsymbols_of_death
[cds]
Combo 2 76.7/100 77% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:43.594Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:43.594Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:44.599Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:45.603Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:46.608Fcold_blood
[cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:46.608Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:47.613Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(10), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:48.618Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:49.622Dshadowstrike
[build]
Fluffy_Pillow 93.2/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:50.626Mcoup_de_grace
[finish]
Fluffy_Pillow 67.1/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:51.831Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:52.836Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:53.840Neviscerate
[finish]
Fluffy_Pillow 86.8/100 87% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:54.843Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:55.848Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:56.852Hsymbols_of_death
[cds]
Combo 2 97.7/100 98% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
1:56.852Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:57.855Lrupture
[finish]
Fluffy_Pillow 70.8/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:58.860Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:59.864Qshadow_dance
[stealth_cds]
Combo 2 70.8/100 71% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:59.864Ksecret_technique
[finish]
Fluffy_Pillow 70.8/100 71% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), premeditation, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:00.870Dshadowstrike
[build]
Fluffy_Pillow 89.7/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
2:01.874Neviscerate
[finish]
Fluffy_Pillow 63.5/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:02.880Dshadowstrike
[build]
Fluffy_Pillow 82.4/100 82% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:03.885Neviscerate
[finish]
Fluffy_Pillow 48.2/100 48% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:04.890Dshadowstrike
[build]
Fluffy_Pillow 75.1/100 75% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:05.894Neviscerate
[finish]
Fluffy_Pillow 40.9/100 41% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:06.899Dshadowstrike
[build]
Fluffy_Pillow 59.8/100 60% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
2:08.091Mcoup_de_grace
[finish]
Fluffy_Pillow 35.6/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:09.295Rvanish
[stealth_cds]
Combo 2 89.6/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
2:09.295Dshadowstrike
[build]
Fluffy_Pillow 89.6/100 90% energy
0.0/7 0% CP
slice_and_dice, vanish, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
2:10.299Neviscerate
[finish]
Fluffy_Pillow 55.5/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
2:11.304Hsymbols_of_death
[cds]
Combo 2 74.3/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), deeper_daggers, flask_of_alchemical_chaos_vers
2:11.304Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(8), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:12.308Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:13.311Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:14.314Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:15.320Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:16.325Ebackstab
[build]
Fluffy_Pillow 70.8/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:17.331Neviscerate
[finish]
Fluffy_Pillow 57.7/100 58% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:18.335Ebackstab
[build]
Fluffy_Pillow 71.5/100 72% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(6), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:19.339Neviscerate
[finish]
Fluffy_Pillow 42.8/100 43% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
2:20.344Ebackstab
[build]
Fluffy_Pillow 62.2/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
2:21.347Ebackstab
[build]
Fluffy_Pillow 49.6/100 50% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
2:22.709Ksecret_technique
[finish]
Fluffy_Pillow 33.1/100 33% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
2:23.713Ebackstab
[build]
Fluffy_Pillow 57.5/100 57% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(5), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
2:25.353Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:26.357Ebackstab
[build]
Fluffy_Pillow 46.5/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:29.075Ebackstab
[build]
Fluffy_Pillow 45.4/100 45% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:31.863Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:34.570Lrupture
[finish]
Fluffy_Pillow 35.8/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, flask_of_alchemical_chaos_haste
2:35.576Ebackstab
[build]
Fluffy_Pillow 57.2/100 57% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_haste
2:37.330Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_haste
2:40.068Ebackstab
[build]
Fluffy_Pillow 44.2/100 44% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(3), flask_of_alchemical_chaos_haste
2:42.147Mcoup_de_grace
[finish]
Fluffy_Pillow 35.8/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(3), flask_of_alchemical_chaos_haste
2:43.350Ebackstab
[build]
Fluffy_Pillow 74.5/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
2:44.357Ebackstab
[build]
Fluffy_Pillow 49.9/100 50% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:46.316Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:47.320Ebackstab
[build]
Fluffy_Pillow 42.6/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:50.031Ebackstab
[build]
Fluffy_Pillow 40.5/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:53.106Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:55.941Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:56.945Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:59.850Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
3:00.000Ebackstab
[build]
Fluffy_Pillow 42.7/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:01.455Jflagellation
[cds]
Fluffy_Pillow 17.6/100 18% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(2), flawless_form(2), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:02.459Hsymbols_of_death
[cds]
Combo 2 31.9/100 32% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(2), flawless_form(2), shadow_techniques, flagellation_buff, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:02.459Qshadow_dance
[stealth_cds]
Combo 2 71.9/100 72% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:02.459Ksecret_technique
[finish]
Fluffy_Pillow 71.9/100 72% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:03.464Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:03.464Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:04.468Neviscerate
[finish]
Fluffy_Pillow 65.3/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(3), the_rotten, flagellation_buff(9), bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:05.472Dshadowstrike
[build]
Fluffy_Pillow 98.7/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(5), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:06.477Ishadow_blades
[cds]
Combo 2 64.2/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, escalating_blade(4), flawless_form(5), shadow_techniques, flagellation_buff(19), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:06.477Mcoup_de_grace
[finish]
Fluffy_Pillow 64.2/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, escalating_blade(4), flawless_form(5), shadow_techniques, flagellation_buff(19), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:07.684Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(10), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:08.688Neviscerate
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(10), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:09.691Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:10.696Lrupture
[finish]
Fluffy_Pillow 50.1/100 50% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:11.700Neviscerate
[finish]
Fluffy_Pillow 78.9/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:12.703Hsymbols_of_death
[cds]
Combo 2 97.8/100 98% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:12.703Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:12.703Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:13.709Fcold_blood
[cds]
Combo 2 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:13.709Ksecret_technique
[finish]
Fluffy_Pillow 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:14.713Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(8), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:15.718Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:16.722Neviscerate
[finish]
Fluffy_Pillow 99.7/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:17.727Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:18.732Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:19.737Dshadowstrike
[build]
Fluffy_Pillow 76.6/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:20.741Neviscerate
[finish]
Fluffy_Pillow 50.4/100 50% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:21.746Ebackstab
[build]
Fluffy_Pillow 61.2/100 61% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:22.751Neviscerate
[finish]
Fluffy_Pillow 40.0/100 40% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:23.755Neviscerate
[finish]
Fluffy_Pillow 58.8/100 59% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:24.763Ebackstab
[build]
Fluffy_Pillow 69.9/100 70% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:25.769Hsymbols_of_death
[cds]
Combo 2 48.9/100 49% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:25.769Qshadow_dance
[stealth_cds]
Combo 2 88.9/100 89% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:25.769Ksecret_technique
[finish]
Fluffy_Pillow 88.9/100 89% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:26.773Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:27.778Mcoup_de_grace
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:28.983Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(8), the_rotten, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:29.988Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:30.995Dshadowstrike
[build]
Fluffy_Pillow 85.1/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:31.999Neviscerate
[finish]
Fluffy_Pillow 51.1/100 51% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:33.004Dshadowstrike
[build]
Fluffy_Pillow 70.1/100 70% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:34.009Neviscerate
[finish]
Fluffy_Pillow 44.1/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:35.014Ebackstab
[build]
Fluffy_Pillow 55.2/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:36.686Ebackstab
[build]
Fluffy_Pillow 49.5/100 49% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:38.264Neviscerate
[finish]
Fluffy_Pillow 42.8/100 43% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:39.269Ebackstab
[build]
Fluffy_Pillow 53.7/100 54% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
3:40.275Lrupture
[finish]
Fluffy_Pillow 32.5/100 33% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:41.280Ebackstab
[build]
Fluffy_Pillow 56.3/100 56% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:43.213Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
3:46.085Neviscerate
[finish]
Fluffy_Pillow 40.0/100 40% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:47.091Ebackstab
[build]
Fluffy_Pillow 54.8/100 55% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
3:49.192Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:50.195Hsymbols_of_death
[cds]
Combo 2 13.1/100 13% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:50.195Qshadow_dance
[stealth_cds]
Combo 2 53.1/100 53% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:50.195Ksecret_technique
[finish]
Fluffy_Pillow 53.1/100 53% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:51.199Dshadowstrike
[build]
Fluffy_Pillow 87.5/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
3:52.204Neviscerate
[finish]
Fluffy_Pillow 61.9/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:53.209Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(8), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:54.212Mcoup_de_grace
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:55.418Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:56.422Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:57.425Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_haste
3:58.429Neviscerate
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
3:59.433Ebackstab
[build]
Fluffy_Pillow 79.6/100 80% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_haste
4:00.437Neviscerate
[finish]
Fluffy_Pillow 51.0/100 51% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_haste
4:01.440Ebackstab
[build]
Fluffy_Pillow 62.4/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_haste
4:02.445Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
4:05.026Ebackstab
[build]
Fluffy_Pillow 43.1/100 43% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
4:06.709Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
4:07.713Ebackstab
[build]
Fluffy_Pillow 51.6/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
4:10.300Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, flask_of_alchemical_chaos_haste
4:13.134Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), flask_of_alchemical_chaos_haste
4:15.904Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_haste
4:16.907Rvanish
[stealth_cds]
Combo 2 51.4/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
4:16.907Dshadowstrike
[build]
Fluffy_Pillow 51.4/100 51% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
4:19.084Neviscerate
[finish]
Fluffy_Pillow 37.9/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form(2), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
4:20.088Ebackstab
[build]
Fluffy_Pillow 48.4/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form, shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
4:22.290Neviscerate
[finish]
Fluffy_Pillow 35.5/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
4:23.293Ebackstab
[build]
Fluffy_Pillow 45.1/100 45% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:25.929Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:28.596Neviscerate
[finish]
Fluffy_Pillow 37.2/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:29.599Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:30.602Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 13.5/100 13% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), deeper_daggers, flask_of_alchemical_chaos_vers
4:32.840Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
4:33.845Jflagellation
[cds]
Fluffy_Pillow 11.8/100 12% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
4:34.849Hsymbols_of_death
[cds]
Combo 2 26.4/100 26% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), shadow_techniques, flagellation_buff, deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
4:34.849Qshadow_dance
[stealth_cds]
Combo 2 66.4/100 66% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade(3), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
4:34.849Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 66.4/100 66% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
4:34.849Ksecret_technique
[finish]
Fluffy_Pillow 66.4/100 66% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:35.854Dshadowstrike
[build]
Fluffy_Pillow 95.2/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:36.859Ishadow_blades
[cds]
Combo 2 60.9/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(9), bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:36.859Mcoup_de_grace
[finish]
Fluffy_Pillow 60.9/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(9), bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:38.063Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(5), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:39.067Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_buff(24), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:40.070Neviscerate
[finish]
Fluffy_Pillow 92.7/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:41.075Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:42.081Neviscerate
[finish]
Fluffy_Pillow 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:43.085Ebackstab
[build]
Fluffy_Pillow 84.7/100 85% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:44.090Lrupture
[finish]
Fluffy_Pillow 63.5/100 64% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:45.096Hsymbols_of_death
[cds]
Combo 2 84.4/100 84% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:45.096Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques, the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:45.096Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:46.102Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:47.106Fcold_blood
[cds]
Combo 2 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:47.106Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(3), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:48.111Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:49.116Mcoup_de_grace
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:50.322Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:51.328Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:52.331Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:53.336Ebackstab
[build]
Fluffy_Pillow 85.0/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:54.340Neviscerate
[finish]
Fluffy_Pillow 64.0/100 64% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:55.344Ebackstab
[build]
Fluffy_Pillow 83.1/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:56.347Ebackstab
[build]
Fluffy_Pillow 62.1/100 62% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:57.351Neviscerate
[finish]
Fluffy_Pillow 41.1/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:58.357Ebackstab
[build]
Fluffy_Pillow 52.1/100 52% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:59.831Ebackstab
[build]
Fluffy_Pillow 44.3/100 44% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:02.754Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:03.758Ebackstab
[build]
Fluffy_Pillow 51.2/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
5:05.040Hsymbols_of_death
[cds]
Combo 2 29.0/100 29% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
5:05.040Qshadow_dance
[stealth_cds]
Combo 2 69.0/100 69% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
5:05.040Ksecret_technique
[finish]
Fluffy_Pillow 69.0/100 69% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
5:06.045Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
5:07.048Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(7), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
5:08.256Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
5:09.259Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
5:10.264Dshadowstrike
[build]
Fluffy_Pillow 73.8/100 74% energy
3.0/7 43% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
5:11.269Neviscerate
[finish]
Fluffy_Pillow 47.6/100 48% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
5:12.274Dshadowstrike
[build]
Fluffy_Pillow 66.4/100 66% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
5:13.279Gpotion
[cds]
Fluffy_Pillow 40.2/100 40% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
5:13.279Lrupture
[finish]
Fluffy_Pillow 40.2/100 40% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:14.282Ebackstab
[build]
Fluffy_Pillow 61.4/100 61% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:15.286Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:17.757Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:18.763Ebackstab
[build]
Fluffy_Pillow 55.6/100 56% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:20.271Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:22.766Neviscerate
[finish]
Fluffy_Pillow 38.7/100 39% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:23.772Ebackstab
[build]
Fluffy_Pillow 50.6/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:25.975Ebackstab
[build]
Fluffy_Pillow 40.5/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:28.249Ksecret_technique
[finish]
Fluffy_Pillow 31.3/100 31% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:29.254Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:30.257Hsymbols_of_death
[cds]
Combo 2 19.0/100 19% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:30.257Neviscerate
[finish]
Fluffy_Pillow 59.0/100 59% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade(3), flawless_form(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:31.263Ebackstab
[build]
Fluffy_Pillow 73.8/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:32.267Mcoup_de_grace
[finish]
Fluffy_Pillow 53.7/100 54% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(4), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:33.470Qshadow_dance
[stealth_cds]
Combo 2 95.8/100 96% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
5:33.470Dshadowstrike
[build]
Fluffy_Pillow 95.8/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), premeditation, shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
5:34.475Neviscerate
[finish]
Fluffy_Pillow 70.7/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
5:35.480Dshadowstrike
[build]
Fluffy_Pillow 90.5/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(8), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
5:36.485Neviscerate
[finish]
Fluffy_Pillow 57.4/100 57% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
5:37.489Dshadowstrike
[build]
Fluffy_Pillow 77.2/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
5:38.494Neviscerate
[finish]
Fluffy_Pillow 52.0/100 52% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
5:39.499Dshadowstrike
[build]
Fluffy_Pillow 63.9/100 64% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
5:40.503Neviscerate
[finish]
Fluffy_Pillow 38.7/100 39% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
5:41.508Ebackstab
[build]
Fluffy_Pillow 58.5/100 59% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (26976)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste8.16%2.79%1843
Versatility24.83%22.21%17321
Attack Power6162857457938
Mastery66.00%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Void Reaper's Contract
ilevel: 639, stats: { +3,607 Agi }
item effects: { equip: Void Reaper's Contract }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 2"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=void_reapers_contract,id=212456,bonus_id=6652/10356/10299/1540/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 3 : 1,473,622 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,473,621.51,473,621.52,801.9 / 0.190%198,247.7 / 13.5%49,279.7
Resource Out In Waiting APM Active
Energy29.929.711.67%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 31,473,622
Auto Attack 0 (70,256)0.0% (4.8%)3.9122.34s5,369,7080

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,9033.2%354.80.98s39,66040,563Direct354.838,40077,33439,65719.4%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.84354.840.000.000.000.97770.000014,073,079.9918,360,913.2823.35%40,562.6240,562.62
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.22%227.8816229538,400.0823,45664,93338,414.3936,66140,9078,750,19911,416,97723.36%
crit19.40%68.834210577,333.7046,071130,06177,401.8170,22088,4135,322,8816,943,93623.34%
miss16.38%58.1431870.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,3531.6%354.50.98s19,77520,158Direct354.519,12538,61119,77319.4%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.48354.480.000.000.000.98100.00007,009,657.599,145,209.9323.35%20,157.7020,157.70
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.21%227.6116130319,125.2311,33032,33419,132.0318,21020,1194,352,8695,679,46323.36%
crit19.41%68.803911138,611.4522,76364,73438,635.9834,27942,9822,656,7893,465,74723.34%
miss16.38%58.0732890.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,3282.1%75.73.68s120,543120,004Direct75.772,949189,038120,54141.0%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.6775.670.000.000.001.00450.00009,121,377.9211,932,765.5123.56%120,003.92120,003.92
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit59.01%44.65237072,948.7457,139141,74572,966.2568,79777,9463,257,4364,263,40823.58%
crit40.99%31.021550189,037.53125,912412,511189,110.55174,178214,7105,863,9427,669,35823.56%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.67

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 88,768 (126,681)6.0% (8.6%)13.322.46s2,857,9772,372,758Direct39.8 (78.2)517,3791,037,378668,84729.1% (29.1%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3039.850.000.000.001.20450.000026,643,436.5134,687,842.2323.19%2,372,757.792,372,757.79
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.88%28.241443517,379.40119,7431,895,827517,330.62356,240720,01114,604,53319,014,84123.20%
crit29.12%11.603231,037,378.08239,8463,637,3581,037,342.15409,5661,825,01612,038,90315,673,00123.20%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.30
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 37,9132.6%0.00.00s00Direct38.3229,991459,628296,82329.1%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.340.000.000.000.00000.000011,375,261.5211,375,261.520.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.90%27.181540229,990.7054,533822,477230,058.73161,028317,2116,248,3786,248,3780.00%
crit29.10%11.16224459,627.58114,3451,647,376460,813.42189,097866,7015,126,8835,126,8830.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,160)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,1601.4%22.412.97s269,5440Direct22.4269,6820269,6820.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.4422.430.000.000.000.00000.00006,048,244.816,048,244.810.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.431138269,682.40260,578318,039269,681.74262,688279,1116,048,2456,048,2450.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 256,978 (367,457)17.4% (24.9%)68.74.37s1,602,7111,595,536Direct68.7 (136.2)858,4361,757,6701,120,94329.2% (29.0%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.7268.720.000.000.001.00450.000077,023,997.58100,193,682.7323.12%1,595,536.331,595,536.33
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.82%48.672965858,436.43210,8622,464,557858,228.79698,4431,024,00141,769,35854,336,40523.13%
crit29.18%20.068351,757,670.23422,3574,977,2041,760,947.781,267,5422,470,58835,254,64045,857,27823.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.73

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,4797.5%67.54.45s490,8840Direct67.5377,013771,306490,95328.9%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.4767.470.000.000.000.00000.000033,120,661.7133,120,661.710.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.11%47.983071377,013.00100,5271,078,027377,092.19291,715458,28218,082,35218,082,3520.00%
crit28.89%19.49734771,306.21201,3562,110,583771,339.58504,8541,142,87815,038,31015,038,3100.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,025 (21,017)0.1% (1.4%)3.791.34s1,698,5011,691,247Direct3.7 (27.6)69,761139,70382,65118.4% (19.5%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000306,865.16306,865.160.00%1,691,246.721,691,246.72
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.63%3.030469,760.5060,925136,87669,482.470100,123211,544211,5440.00%
crit18.37%0.6804139,702.95122,033282,23773,324.000282,23795,32195,3210.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 19,9911.4%0.00.00s00Direct23.9209,643420,313251,08219.7%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.910.000.000.000.00000.00006,001,485.106,001,485.100.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.34%19.21727209,643.3976,622452,357209,496.07176,734246,3074,025,5864,025,5860.00%
crit19.66%4.70013420,312.87159,472902,923418,997.130815,0211,975,8991,975,8990.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,2170.8%0.00.00s00Direct283.810,79421,76012,91519.3%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00283.830.000.000.000.00000.00003,665,632.993,665,632.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.66%228.9315930510,794.297,51417,72410,798.9810,07311,4462,471,1822,471,1820.00%
crit19.34%54.90278621,760.3815,05135,50121,767.5019,38424,3471,194,4511,194,4510.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,749 (116,868)6.7% (7.9%)9.531.40s3,673,5153,657,336Periodic167.6 (335.3)135,600281,028176,77328.3% (28.2%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.550.00167.63167.637.021.00451.739829,632,155.9929,632,155.990.00%116,428.723,657,335.94
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.69%120.1784159135,600.32127431,632135,662.76118,938153,68416,294,11216,294,1120.00%
crit28.31%47.452472281,028.29263884,408281,487.57224,823348,77313,338,04413,338,0440.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.55
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1201.2%167.61.76s32,4420Periodic167.624,96851,63032,44128.0%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.630.000.00167.630.000.00000.00005,438,038.305,438,038.300.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.97%120.638516624,967.529,67180,86224,986.5622,33628,6093,011,8503,011,8500.00%
crit28.03%46.99247451,629.7519,371162,16651,688.0637,44165,5742,426,1882,426,1880.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (271,274)0.0% (18.4%)16.019.04s5,076,8745,054,361

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.030.000.000.000.001.00450.00000.000.000.00%5,054,361.385,054,361.38

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.02
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,4914.7%0.00.00s00Direct16.0685,0382,125,3191,300,84042.8%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.030.000.000.000.00000.000020,836,713.9427,163,091.6223.29%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.25%9.17315685,037.96156,5471,560,777685,692.91481,3671,012,1556,281,8268,213,58023.52%
crit42.75%6.853132,125,318.76312,6794,332,9462,168,557.781,384,1313,387,76114,554,88818,949,51223.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 201,78313.7%0.00.00s00Direct32.0995,5753,036,6981,895,15244.1%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.960.000.000.000.00000.000060,528,395.5960,528,395.590.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.94%17.88926995,575.30222,2922,257,070996,798.45760,3831,303,44117,792,85417,792,8540.00%
crit44.06%14.087243,036,697.61475,2276,265,9563,067,034.091,984,0304,239,91742,735,54242,735,5420.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (104,847)0.0% (7.1%)3.690.86s8,626,3760

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 104,8477.1%385.61.20s81,5910Periodic385.681,591081,5910.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage385.600.000.00385.600.000.00000.000031,461,672.1731,461,672.170.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%385.6029046981,591.33781,128,83081,669.4369,72194,78531,461,67231,461,6720.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6702.71
  • base_dd_max:6702.71
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,5658.0%52.35.84s673,564670,549Direct52.3280,522916,316673,70361.8%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.3052.300.000.000.001.00450.000035,226,645.8245,932,541.6123.31%670,549.47670,549.47
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.17%19.961030280,521.70130,261412,695280,521.61250,027313,6485,599,9187,295,86023.25%
crit61.83%32.332144916,316.26287,0431,427,015917,043.17829,226997,20429,626,72738,636,68123.32%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.29

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,8620.3%2.468.11s477,4580Direct2.4400,460807,739478,32619.0%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.422.420.000.000.000.00000.00001,157,155.491,157,155.490.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.00%1.9609400,460.02377,346473,681342,313.300473,681785,476785,4760.00%
crit19.00%0.4604807,739.09755,824953,084291,848.010953,084371,680371,6800.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8740.1%2.470.40s109,9500Direct2.491,663183,417110,02019.9%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.382.380.000.000.000.00000.0000262,207.91262,207.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.07%1.910891,663.4983,958124,51778,305.210124,517175,032175,0320.00%
crit19.93%0.4804183,417.23168,168227,66769,922.710225,28987,17687,1760.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67920.01
  • base_dd_max:67920.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,3003.2%19.315.79s738,5900Periodic108.0131,8040131,8040.0%0.0%71.9%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.260.00107.99107.9912.230.00002.000014,227,547.4414,227,547.440.00%65,877.120.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.9952153131,803.9460,995218,384130,796.8876,502179,20714,227,54714,227,5470.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 73,4155.0%37.18.04s594,2540Direct37.1496,700996,514594,36919.5%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage37.1037.100.000.000.000.00000.000022,047,057.3622,047,057.360.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.49%29.861451496,700.13453,001866,663496,508.75468,623541,72014,834,68414,834,6840.00%
crit19.51%7.24018996,513.87907,3601,705,547995,971.9401,433,4227,212,3747,212,3740.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,4180.3%2.379.74s575,9010Direct2.3480,673964,419576,60219.7%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.312.310.000.000.000.00000.00001,328,293.991,328,293.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.32%1.8507480,673.20452,539578,744403,465.630565,050890,449890,4490.00%
crit19.68%0.4505964,418.54906,4361,161,032355,815.0001,161,032437,845437,8450.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,0825.8%58.15.18s439,3230Direct58.1368,003740,301439,38419.2%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.1258.120.000.000.000.00000.000025,533,847.8633,354,518.0223.45%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.84%46.982666368,002.78220,828572,130368,150.73342,017395,56417,289,07522,588,11023.46%
crit19.16%11.14224740,301.05442,3191,134,258741,113.60532,6711,008,3118,244,77310,766,40823.43%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 3
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.68s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.26s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.711.21s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.680.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.470.63s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.390.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.366.80s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.340.0068.700.000.290.00000.83420.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5307.55s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.48
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 99.03.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.960.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.362.05s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.330.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.23s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.31
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.470.40s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.382.380.000.000.000.00000.00000.001,637,267.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.380100.00000.000001,637,26891.63%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8740.1%2.470.40s109,9500Direct2.491,663183,417110,02019.9%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.382.380.000.000.000.00000.0000262,207.91262,207.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.07%1.910891,663.4983,958124,51778,305.210124,517175,032175,0320.00%
crit19.93%0.4804183,417.23168,168227,66769,922.710225,28987,17687,1760.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67920.01
  • base_dd_max:67920.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.39s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.29
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.34s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.372.56s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1592.0173.8s0.5s276.8s99.95%100.00%582.3 (582.3)0.1

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:11.0s / 332.8s
  • trigger_min/max:0.0s / 4.6s
  • trigger_pct:100.00%
  • duration_min/max:2.2s / 359.9s
  • uptime_min/max:99.18% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.16%
  • acrobatic_strikes_10:98.31%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.6119.6s3.5s128.4s97.35%0.00%74.3 (77.1)1.3

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 331.8s
  • trigger_min/max:1.0s / 43.0s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 357.0s
  • uptime_min/max:88.57% / 99.44%

Stack Uptimes

  • alacrity_1:2.93%
  • alacrity_2:2.24%
  • alacrity_3:1.76%
  • alacrity_4:1.65%
  • alacrity_5:88.78%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.50%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.64%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.019.0s19.0s6.9s36.97%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 57.0s
  • trigger_min/max:9.2s / 57.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.89% / 40.89%

Stack Uptimes

  • bolstering_shadows_1:36.97%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.2s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:84.6s / 100.9s
  • trigger_min/max:84.6s / 100.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 0.2s
  • uptime_min/max:0.00% / 0.08%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0130.2s114.7s4.3s1.84%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 279.4s
  • trigger_min/max:90.0s / 195.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:0.00% / 8.38%

Stack Uptimes

  • cryptic_instructions_1:1.84%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.347.923.2s23.2s8.2s36.41%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 70.9s
  • trigger_min/max:8.0s / 70.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.41% / 39.24%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.53%
  • danse_macabre_3:6.59%
  • danse_macabre_4:16.58%
  • danse_macabre_5:8.66%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.440.8s3.7s35.6s90.15%95.71%74.4 (74.4)6.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 166.5s
  • trigger_min/max:1.0s / 40.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 163.1s
  • uptime_min/max:81.28% / 96.74%

Stack Uptimes

  • deeper_daggers_1:90.15%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.019.0s19.0s3.4s18.32%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 57.0s
  • trigger_min/max:9.2s / 57.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.15% / 21.20%

Stack Uptimes

  • disorienting_strikes_1:12.17%
  • disorienting_strikes_2:6.15%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0130.0s114.3s4.0s1.65%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 275.8s
  • trigger_min/max:90.0s / 222.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 11.2s
  • uptime_min/max:0.00% / 7.02%

Stack Uptimes

  • errant_manaforge_emission_1:1.65%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.022.1s5.2s17.3s81.45%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 59.7s
  • trigger_min/max:1.0s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.7s
  • uptime_min/max:63.06% / 92.48%

Stack Uptimes

  • escalating_blade_1:24.90%
  • escalating_blade_2:22.01%
  • escalating_blade_3:22.65%
  • escalating_blade_4:11.89%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.7s18.18%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:82.4s / 183.0s
  • trigger_min/max:82.4s / 183.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:12.87% / 20.85%

Stack Uptimes

  • ethereal_powerlink_1:18.18%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.284.1s71.7s15.4s10.65%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4464.05

Trigger Details

  • interval_min/max:15.2s / 325.7s
  • trigger_min/max:1.0s / 325.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.0s
  • uptime_min/max:0.00% / 46.79%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.65%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.63%0.00%14.3 (96.6)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.2s
  • trigger_min/max:1.0s / 88.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.99% / 16.90%

Stack Uptimes

  • flagellation_buff_1:1.32%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.76%
  • flagellation_buff_9:0.59%
  • flagellation_buff_10:0.56%
  • flagellation_buff_11:0.48%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.03%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.41%
  • flagellation_buff_20:0.40%
  • flagellation_buff_21:0.32%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.19%
  • flagellation_buff_25:0.84%
  • flagellation_buff_26:0.36%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.21%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.10%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.23%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.2s / 98.2s
  • trigger_min/max:78.2s / 98.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s
  • uptime_min/max:12.32% / 16.23%

Stack Uptimes

  • flagellation_persist_13:0.00%
  • flagellation_persist_30:14.22%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6112.3s77.9s35.2s24.94%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 191.2s
  • uptime_min/max:0.00% / 72.49%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.94%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6111.8s76.5s35.5s25.28%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:31.0s / 321.1s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 77.58%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.28%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6110.8s77.6s34.8s24.72%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:31.9s / 334.3s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 180.0s
  • uptime_min/max:0.00% / 76.18%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.72%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.20.6113.4s76.0s35.0s25.06%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.4s / 351.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 77.73%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.06%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.50.039.7s3.4s59.6s95.32%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.63%
  • flawless_form_2:8.77%
  • flawless_form_3:11.78%
  • flawless_form_4:9.73%
  • flawless_form_5:2.71%
  • flawless_form_6:4.43%
  • flawless_form_7:5.89%
  • flawless_form_8:11.40%
  • flawless_form_9:18.50%
  • flawless_form_10:8.73%
  • flawless_form_11:1.43%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.16%
  • flawless_form_16:0.08%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.286.3s73.3s16.8s10.81%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.8s / 298.3s
  • trigger_min/max:0.1s / 298.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 54.8s
  • uptime_min/max:0.00% / 46.52%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.81%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.287.0s73.6s17.1s10.94%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:5.2s / 308.3s
  • trigger_min/max:0.3s / 308.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 64.3s
  • uptime_min/max:0.00% / 37.75%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.94%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.287.5s73.6s17.2s10.90%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.1s / 323.8s
  • trigger_min/max:0.3s / 323.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 52.8s
  • uptime_min/max:0.00% / 49.92%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.90%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.286.3s72.2s17.1s10.72%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:4.2s / 339.6s
  • trigger_min/max:0.3s / 310.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.3s
  • uptime_min/max:0.00% / 40.61%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.72%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.90.422.1s21.3s3.7s17.11%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.8s
  • trigger_min/max:1.0s / 64.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:9.43% / 28.89%

Stack Uptimes

  • poised_shadows_1:17.11%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.60%11.21%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 64.5s
  • trigger_min/max:1.0s / 64.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.41% / 4.70%

Stack Uptimes

  • premeditation_1:2.60%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0133.1s113.5s4.0s1.64%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 296.4s
  • trigger_min/max:90.0s / 187.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.7s
  • uptime_min/max:0.00% / 6.72%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.64%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.282.7s69.1s15.5s10.72%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:24772.46

Trigger Details

  • interval_min/max:15.0s / 330.3s
  • trigger_min/max:1.0s / 330.3s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 42.5s
  • uptime_min/max:0.00% / 43.59%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.72%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.60.090.9s90.9s15.8s19.19%17.14%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.4s
  • trigger_min/max:90.0s / 98.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 16.0s
  • uptime_min/max:16.84% / 21.86%

Stack Uptimes

  • shadow_blades_1:19.19%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.2s23.2s8.2s36.41%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 70.9s
  • trigger_min/max:8.0s / 70.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.41% / 39.24%

Stack Uptimes

  • shadow_dance_1:36.41%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.3138.54.4s1.5s3.5s79.17%95.47%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 45.6s
  • trigger_min/max:0.5s / 6.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.8s
  • uptime_min/max:72.02% / 87.44%

Stack Uptimes

  • shadow_techniques_1:20.59%
  • shadow_techniques_2:20.83%
  • shadow_techniques_3:9.45%
  • shadow_techniques_4:10.45%
  • shadow_techniques_5:6.08%
  • shadow_techniques_6:5.84%
  • shadow_techniques_7:2.58%
  • shadow_techniques_8:2.31%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.46%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s298.3s99.32%87.71%99.0 (99.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.3s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.40.0103.8s99.3s9.8s1.31%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:14.2s / 335.1s
  • trigger_min/max:3.0s / 265.6s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 18.4s
  • uptime_min/max:0.00% / 10.09%

Stack Uptimes

  • storm_sewers_citrine_1:1.31%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0113.0s104.0s9.9s1.24%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:5.0s / 284.2s
  • trigger_min/max:6.3s / 284.2s
  • trigger_pct:100.00%
  • duration_min/max:1.7s / 19.0s
  • uptime_min/max:0.00% / 12.18%

Stack Uptimes

  • storm_sewers_citrine_1:1.24%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0109.4s95.6s10.0s1.33%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:3.0s / 303.5s
  • trigger_min/max:2.0s / 303.5s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 19.9s
  • uptime_min/max:0.00% / 11.18%

Stack Uptimes

  • storm_sewers_citrine_1:1.33%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0110.9s101.0s9.8s1.31%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:4.0s / 296.0s
  • trigger_min/max:3.7s / 296.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.2s
  • uptime_min/max:0.00% / 11.84%

Stack Uptimes

  • storm_sewers_citrine_1:1.31%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0118.6s104.4s9.9s1.29%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.8s / 299.4s
  • trigger_min/max:2.5s / 278.6s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 18.6s
  • uptime_min/max:0.00% / 14.17%

Stack Uptimes

  • storm_sewers_citrine_1:1.29%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.282.4s70.2s15.4s10.60%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1374.86
  • stat:haste_rating
  • amount:1374.86
  • stat:mastery_rating
  • amount:1374.86
  • stat:versatility_rating
  • amount:1374.86

Trigger Details

  • interval_min/max:15.1s / 314.8s
  • trigger_min/max:0.9s / 314.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.8s
  • uptime_min/max:0.00% / 36.24%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.60%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.4s21.4s2.3s10.98%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 64.5s
  • trigger_min/max:3.0s / 64.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.2s
  • uptime_min/max:9.22% / 14.74%

Stack Uptimes

  • supercharge_1_1:10.98%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.04%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 64.5s
  • trigger_min/max:1.0s / 64.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:0.56% / 5.28%

Stack Uptimes

  • supercharge_2_1:2.04%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s0.9s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.0s
  • uptime_min/max:0.00% / 0.69%

Stack Uptimes

  • supercharge_3_1:0.00%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.5s21.3s24.5s61.11%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.2s / 97.2s
  • trigger_min/max:1.0s / 64.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:57.61% / 65.29%

Stack Uptimes

  • symbols_of_death_1:61.11%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0308.0s308.0s27.5s13.34%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.6s
  • trigger_min/max:300.0s / 329.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.95% / 18.10%

Stack Uptimes

  • tempered_potion_1:13.34%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.80%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.4s21.3s2.9s13.76%22.25%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 64.5s
  • trigger_min/max:1.0s / 64.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.2s
  • uptime_min/max:10.86% / 17.02%

Stack Uptimes

  • the_rotten_1:10.72%
  • the_rotten_2:3.04%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.2s
  • trigger_min/max:120.0s / 136.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.39%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.0138.4s39.8s15.2s0.39%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4550.35

Trigger Details

  • interval_min/max:87.3s / 197.8s
  • trigger_min/max:2.8s / 197.8s
  • trigger_pct:100.00%
  • duration_min/max:3.2s / 27.3s
  • uptime_min/max:0.00% / 9.88%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.43%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.00.286.0s73.6s15.3s10.38%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5694.82

Trigger Details

  • interval_min/max:15.3s / 315.4s
  • trigger_min/max:1.0s / 315.4s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 42.3s
  • uptime_min/max:0.00% / 34.14%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.38%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.226.081.06.0s0.7s62.6s
Skyfury (Off Hand)49.427.075.06.0s0.7s55.9s
Supercharger secret_technique12.47.016.023.7s9.2s92.1s
Cold Blood secret_technique3.63.04.090.7s84.6s101.1s
Supercharger rupture0.30.03.0161.5s42.9s290.4s
Supercharger coup_de_grace2.70.08.077.1s9.2s326.7s
Supercharger eviscerate13.16.020.022.9s1.0s172.2s
CP Spent During Flagellation202.6140.0250.011.1s1.0s90.0s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.33%5.87%13.11%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 3
Energy RegenEnergy1,443.633,044.3234.15%2.11396.5311.52%
Improved AmbushCombo Points52.2933.504.57%0.6418.7935.94%
PremeditationCombo Points17.2356.997.78%3.3163.6252.75%
Relentless StrikesEnergy107.604,280.1348.01%39.78122.972.79%
Shadow BladesCombo Points21.95114.0415.57%5.1917.6813.42%
Shadow TechniquesEnergy359.911,234.7013.85%3.43204.9514.24%
Shadow TechniquesCombo Points85.80241.3032.94%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.28106.9514.60%7.000.000.00%
BackstabCombo Points75.6775.3010.28%1.000.370.49%
ShadowstrikeCombo Points52.29104.5614.27%2.000.010.01%
Symbols of DeathEnergy14.29356.544.00%24.95215.0637.62%
Usage Type Count Total Tot% Avg RPE APR
Combo 3
BackstabEnergy75.673,026.6533.74%40.0040.003,013.69
Coup de GraceEnergy13.30465.475.19%35.0034.9981,677.91
Coup de GraceCombo Points13.3090.7112.45%6.826.82419,113.71
EviscerateEnergy68.732,405.4026.82%35.0035.0045,790.59
EviscerateCombo Points68.73467.9264.21%6.816.81235,392.01
RuptureEnergy9.55238.722.66%25.0025.00146,912.31
RuptureCombo Points9.5565.248.95%6.836.83537,596.87
Secret TechniqueEnergy16.02480.755.36%30.0030.00169,247.59
Secret TechniqueCombo Points16.02104.8714.39%6.546.54775,869.13
ShadowstrikeEnergy52.292,352.9526.23%45.0044.9914,971.24
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6929.87939.145.80.1100.0
Combo Points0.02.442.43100.43.90.07.0

Statistics & Data Analysis

Fight Length
Combo 3 Fight Length
Count 1315
Mean 300.36
Minimum 240.36
Maximum 359.90
Spread ( max - min ) 119.55
Range [ ( max - min ) / 2 * 100% ] 19.90%
DPS
Combo 3 Damage Per Second
Count 1315
Mean 1473621.51
Minimum 1291220.06
Maximum 1629152.05
Spread ( max - min ) 337931.99
Range [ ( max - min ) / 2 * 100% ] 11.47%
Standard Deviation 51840.4671
5th Percentile 1390959.21
95th Percentile 1558658.98
( 95th Percentile - 5th Percentile ) 167699.77
Mean Distribution
Standard Deviation 1429.5720
95.00% Confidence Interval ( 1470819.60 - 1476423.42 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4755
0.1 Scale Factor Error with Delta=300 22941483
0.05 Scale Factor Error with Delta=300 91765931
0.01 Scale Factor Error with Delta=300 2294148258
Priority Target DPS
Combo 3 Priority Target Damage Per Second
Count 1315
Mean 1473621.51
Minimum 1291220.06
Maximum 1629152.05
Spread ( max - min ) 337931.99
Range [ ( max - min ) / 2 * 100% ] 11.47%
Standard Deviation 51840.4671
5th Percentile 1390959.21
95th Percentile 1558658.98
( 95th Percentile - 5th Percentile ) 167699.77
Mean Distribution
Standard Deviation 1429.5720
95.00% Confidence Interval ( 1470819.60 - 1476423.42 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4755
0.1 Scale Factor Error with Delta=300 22941483
0.05 Scale Factor Error with Delta=300 91765931
0.01 Scale Factor Error with Delta=300 2294148258
DPS(e)
Combo 3 Damage Per Second (Effective)
Count 1315
Mean 1473621.51
Minimum 1291220.06
Maximum 1629152.05
Spread ( max - min ) 337931.99
Range [ ( max - min ) / 2 * 100% ] 11.47%
Damage
Combo 3 Damage
Count 1315
Mean 442069432.75
Minimum 338836098.52
Maximum 539203010.71
Spread ( max - min ) 200366912.19
Range [ ( max - min ) / 2 * 100% ] 22.66%
DTPS
Combo 3 Damage Taken Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 3 Healing Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 3 Healing Per Second (Effective)
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 3 Heal
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 3 Healing Taken Per Second
Count 1315
Mean 3022.50
Minimum 0.00
Maximum 11852.07
Spread ( max - min ) 11852.07
Range [ ( max - min ) / 2 * 100% ] 196.06%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.29 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.67 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.48 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.29 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.02 secret_technique,if=variable.secret
L 9.55 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.30 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.73 eviscerate
actions.item
# count action,conditions
O 3.74 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.71 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.31 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0235ODGJNRDLHQPDIKDNNDMNDHNDFKNENENNENEEEHQNDKDMDNDLENEENHQDNDKDDMDNEENENEEHQNDKDNDNDLEEMEENEENEENOEEJHQPKDINDMDNNELHQDFKNDNNDNENEEENEMRDNEEHQKDNDNDNDLEENEEKEEELEEEMEEENEENEOEJHQPKDINDNNDMELHQNFKDNDNNDNENHQDNKDNDMDENENEELEENEHQKDNDMDNDNEENEEKRDNENEEELEEMEEEONEEJHQPKDINDNNDNELHQDMFKDNNDNEENEENHQDNDKNDMGDNEELENEEENEHKENQDMDNDNDNEE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre3trinket_sync_slot
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, cryptic_instructions
0:01.003Gpotion
[cds]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, cryptic_instructions
0:01.003Jflagellation
[cds]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, cryptic_instructions, tempered_potion
0:02.009Neviscerate
[finish]
Fluffy_Pillow 90.3/100 90% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(6), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff, cryptic_instructions, tempered_potion
0:03.014Rvanish
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(9), flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:03.014Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(9), flawless_form, premeditation, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:04.017Lrupture
[finish]
Fluffy_Pillow 68.9/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(9), flawless_form(2), shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, windsingers_runed_citrine_Vers, cryptic_instructions, tempered_potion
0:05.021Hsymbols_of_death
[cds]
Combo 3 92.9/100 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(2), shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, windsingers_runed_citrine_Vers, cryptic_instructions, tempered_potion
0:05.021Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, cryptic_instructions, tempered_potion
0:05.021Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, cryptic_instructions, tempered_potion
0:05.021Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:06.025Ishadow_blades
[cds]
Combo 3 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:06.025Ksecret_technique
[finish]
Fluffy_Pillow 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:07.029Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(3), shadow_techniques(9), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:08.034Neviscerate
[finish]
Fluffy_Pillow 77.2/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(4), shadow_techniques(11), flagellation_buff(25), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:09.039Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:10.042Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:11.048Mcoup_de_grace
[finish]
Fluffy_Pillow 69.3/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(5), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:12.252Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(9), shadow_techniques, flagellation_buff(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:13.255Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:14.259Hsymbols_of_death
[cds]
Combo 3 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:14.259Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:15.266Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, tempered_potion
0:16.271Fcold_blood
[cds]
Combo 3 85.6/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:16.271Ksecret_technique
[finish]
Fluffy_Pillow 85.6/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.276Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:18.280Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:19.283Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.287Ebackstab
[build]
Fluffy_Pillow 97.3/100 97% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:21.290Neviscerate
[finish]
Fluffy_Pillow 79.9/100 80% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:22.295Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.299Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:24.305Neviscerate
[finish]
Fluffy_Pillow 74.7/100 75% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:25.310Ebackstab
[build]
Fluffy_Pillow 92.3/100 92% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:26.314Ebackstab
[build]
Fluffy_Pillow 67.0/100 67% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.318Ebackstab
[build]
Fluffy_Pillow 49.6/100 50% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.323Hsymbols_of_death
[cds]
Combo 3 40.3/100 40% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.323Qshadow_dance
[stealth_cds]
Combo 3 80.3/100 80% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.323Neviscerate
[finish]
Fluffy_Pillow 80.3/100 80% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.328Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:30.333Ksecret_technique
[finish]
Fluffy_Pillow 69.7/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, tempered_potion
0:31.337Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:32.343Mcoup_de_grace
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:33.548Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(8), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:34.554Neviscerate
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:35.559Dshadowstrike
[build]
Fluffy_Pillow 99.2/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(8), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:36.562Lrupture
[finish]
Fluffy_Pillow 68.3/100 68% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:37.565Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:38.569Neviscerate
[finish]
Fluffy_Pillow 90.1/100 90% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:39.572Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:40.577Ebackstab
[build]
Fluffy_Pillow 72.2/100 72% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:41.580Neviscerate
[finish]
Fluffy_Pillow 51.1/100 51% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:42.586Hsymbols_of_death
[cds]
Combo 3 56.9/100 57% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:42.586Qshadow_dance
[stealth_cds]
Combo 3 96.9/100 97% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:42.586Dshadowstrike
[build]
Fluffy_Pillow 96.9/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:43.591Neviscerate
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:44.595Dshadowstrike
[build]
Fluffy_Pillow 96.6/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
0:45.599Ksecret_technique
[finish]
Fluffy_Pillow 62.4/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(4), flawless_form(3), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:46.601Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:47.606Dshadowstrike
[build]
Fluffy_Pillow 73.8/100 74% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:48.609Mcoup_de_grace
[finish]
Fluffy_Pillow 39.6/100 40% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(6), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:49.813Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:50.817Neviscerate
[finish]
Fluffy_Pillow 59.8/100 60% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(11), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:51.822Ebackstab
[build]
Fluffy_Pillow 78.8/100 79% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(11), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:52.827Ebackstab
[build]
Fluffy_Pillow 57.9/100 58% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(11), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:53.831Neviscerate
[finish]
Fluffy_Pillow 36.9/100 37% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(11), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:54.836Ebackstab
[build]
Fluffy_Pillow 55.9/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(5), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:55.951Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:56.954Ebackstab
[build]
Fluffy_Pillow 50.1/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:58.269Ebackstab
[build]
Fluffy_Pillow 40.5/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:59.856Hsymbols_of_death
[cds]
Combo 3 22.0/100 22% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:59.856Qshadow_dance
[stealth_cds]
Combo 3 62.0/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:59.856Neviscerate
[finish]
Fluffy_Pillow 62.0/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:00.857Dshadowstrike
[build]
Fluffy_Pillow 87.9/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:01.861Ksecret_technique
[finish]
Fluffy_Pillow 62.0/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:02.866Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:03.870Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:04.874Dshadowstrike
[build]
Fluffy_Pillow 76.7/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:05.881Neviscerate
[finish]
Fluffy_Pillow 50.6/100 51% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:06.886Dshadowstrike
[build]
Fluffy_Pillow 77.4/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:07.890Lrupture
[finish]
Fluffy_Pillow 43.2/100 43% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:08.894Ebackstab
[build]
Fluffy_Pillow 71.9/100 72% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:09.898Ebackstab
[build]
Fluffy_Pillow 42.7/100 43% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:11.519Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
1:12.723Ebackstab
[build]
Fluffy_Pillow 69.1/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
1:13.832Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_vers
1:16.371Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
1:17.377Ebackstab
[build]
Fluffy_Pillow 42.3/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:20.189Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:23.027Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:24.032Ebackstab
[build]
Fluffy_Pillow 46.4/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:26.778Ebackstab
[build]
Fluffy_Pillow 44.5/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:29.317Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:30.321Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 46.4/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:30.321Ebackstab
[build]
Fluffy_Pillow 46.4/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
1:33.143Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
1:34.148Jflagellation
[cds]
Fluffy_Pillow 11.8/100 12% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
1:35.153Hsymbols_of_death
[cds]
Combo 3 26.6/100 27% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
1:35.153Qshadow_dance
[stealth_cds]
Combo 3 66.6/100 67% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
1:35.153Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 66.6/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
1:35.153Ksecret_technique
[finish]
Fluffy_Pillow 66.6/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:36.159Dshadowstrike
[build]
Fluffy_Pillow 87.4/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:37.164Ishadow_blades
[cds]
Combo 3 61.2/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:37.164Neviscerate
[finish]
Fluffy_Pillow 61.2/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:38.171Dshadowstrike
[build]
Fluffy_Pillow 87.6/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:39.177Mcoup_de_grace
[finish]
Fluffy_Pillow 61.9/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), flagellation_buff(19), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:40.381Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:41.386Neviscerate
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:42.390Neviscerate
[finish]
Fluffy_Pillow 93.7/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:43.394Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:44.397Lrupture
[finish]
Fluffy_Pillow 71.3/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:45.403Hsymbols_of_death
[cds]
Combo 3 92.7/100 93% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:45.403Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:45.403Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), premeditation, shadow_techniques(6), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:46.405Fcold_blood
[cds]
Combo 3 82.3/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:46.405Ksecret_technique
[finish]
Fluffy_Pillow 82.3/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:47.408Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:48.412Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:49.417Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:50.422Neviscerate
[finish]
Fluffy_Pillow 93.7/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:51.427Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:52.432Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:53.437Ebackstab
[build]
Fluffy_Pillow 85.7/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:54.441Neviscerate
[finish]
Fluffy_Pillow 57.0/100 57% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:55.445Ebackstab
[build]
Fluffy_Pillow 68.3/100 68% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:56.450Ebackstab
[build]
Fluffy_Pillow 47.7/100 48% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:58.045Ebackstab
[build]
Fluffy_Pillow 49.2/100 49% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:59.831Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
2:00.835Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
2:03.121Mcoup_de_grace
[finish]
Fluffy_Pillow 35.8/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
2:04.327Rvanish
[stealth_cds]
Combo 3 77.7/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:04.327Dshadowstrike
[build]
Fluffy_Pillow 77.7/100 78% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), flawless_form(6), premeditation, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:05.331Neviscerate
[finish]
Fluffy_Pillow 43.5/100 44% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:06.337Ebackstab
[build]
Fluffy_Pillow 58.3/100 58% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
2:08.068Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
2:09.838Hsymbols_of_death
[cds]
Combo 3 23.9/100 24% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
2:10.022Qshadow_dance
[stealth_cds]
Combo 3 65.9/100 66% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(6), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:10.022Ksecret_technique
[finish]
Fluffy_Pillow 65.9/100 66% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(6), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:11.027Dshadowstrike
[build]
Fluffy_Pillow 99.7/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(7), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
2:12.033Neviscerate
[finish]
Fluffy_Pillow 73.5/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:13.037Dshadowstrike
[build]
Fluffy_Pillow 99.3/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:14.041Neviscerate
[finish]
Fluffy_Pillow 73.1/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:15.046Dshadowstrike
[build]
Fluffy_Pillow 91.9/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:16.050Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:17.056Dshadowstrike
[build]
Fluffy_Pillow 76.5/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
2:18.060Lrupture
[finish]
Fluffy_Pillow 50.3/100 50% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:19.065Ebackstab
[build]
Fluffy_Pillow 66.1/100 66% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:20.069Ebackstab
[build]
Fluffy_Pillow 44.9/100 45% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:22.187Neviscerate
[finish]
Fluffy_Pillow 43.7/100 44% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
2:23.191Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
2:25.787Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:28.173Ksecret_technique
[finish]
Fluffy_Pillow 31.0/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:29.179Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:31.609Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:34.912Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:36.923Lrupture
[finish]
Fluffy_Pillow 26.0/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_mastery
2:37.927Ebackstab
[build]
Fluffy_Pillow 46.8/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_mastery
2:40.755Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_mastery
2:43.636Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), flask_of_alchemical_chaos_mastery
2:46.595Mcoup_de_grace
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:47.800Ebackstab
[build]
Fluffy_Pillow 78.0/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:48.805Ebackstab
[build]
Fluffy_Pillow 48.9/100 49% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:51.454Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:53.946Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:54.950Ebackstab
[build]
Fluffy_Pillow 42.2/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:57.825Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:00.286Neviscerate
[finish]
Fluffy_Pillow 35.8/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:01.290Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:02.294Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 12.4/100 12% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:04.129Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:05.136Jflagellation
[cds]
Fluffy_Pillow 11.1/100 11% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:06.142Hsymbols_of_death
[cds]
Combo 3 26.0/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, flagellation_buff, deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:06.142Qshadow_dance
[stealth_cds]
Combo 3 66.0/100 66% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:06.142Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 66.0/100 66% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:06.142Ksecret_technique
[finish]
Fluffy_Pillow 66.0/100 66% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:07.145Dshadowstrike
[build]
Fluffy_Pillow 99.8/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:08.149Ishadow_blades
[cds]
Combo 3 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:08.149Neviscerate
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:09.153Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:10.158Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_buff(20), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:11.163Neviscerate
[finish]
Fluffy_Pillow 84.7/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_buff(27), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:12.169Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:13.174Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:14.379Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(10), flagellation_buff(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:15.384Lrupture
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(12), flagellation_buff(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:16.389Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:16.389Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(7), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:16.389Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(7), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:17.394Fcold_blood
[cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:17.394Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), premeditation, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:18.398Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:19.403Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:20.408Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:21.412Neviscerate
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:22.416Neviscerate
[finish]
Fluffy_Pillow 69.2/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:23.420Dshadowstrike
[build]
Fluffy_Pillow 88.0/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:24.426Neviscerate
[finish]
Fluffy_Pillow 61.8/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:25.430Ebackstab
[build]
Fluffy_Pillow 80.6/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(7), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:26.434Neviscerate
[finish]
Fluffy_Pillow 59.4/100 59% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:27.439Hsymbols_of_death
[cds]
Combo 3 78.2/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:27.439Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:27.439Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:28.443Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:29.447Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:30.453Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:31.458Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:32.462Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:33.467Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:34.671Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:35.675Ebackstab
[build]
Fluffy_Pillow 73.8/100 74% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:36.679Neviscerate
[finish]
Fluffy_Pillow 60.6/100 61% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:37.684Ebackstab
[build]
Fluffy_Pillow 79.4/100 79% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), deeper_daggers, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:38.689Neviscerate
[finish]
Fluffy_Pillow 50.2/100 50% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:39.693Ebackstab
[build]
Fluffy_Pillow 69.0/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers, storm_sewers_citrine
3:40.698Ebackstab
[build]
Fluffy_Pillow 47.8/100 48% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:41.701Lrupture
[finish]
Fluffy_Pillow 26.5/100 27% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:42.707Ebackstab
[build]
Fluffy_Pillow 55.4/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:44.359Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:46.801Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), flask_of_alchemical_chaos_haste
3:47.804Ebackstab
[build]
Fluffy_Pillow 51.5/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
3:50.084Hsymbols_of_death
[cds]
Combo 3 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:50.084Qshadow_dance
[stealth_cds]
Combo 3 81.4/100 81% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:50.084Ksecret_technique
[finish]
Fluffy_Pillow 81.4/100 81% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:51.088Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
3:52.092Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:53.096Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:54.100Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:55.306Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:56.311Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:57.316Dshadowstrike
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:58.320Neviscerate
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:59.324Ebackstab
[build]
Fluffy_Pillow 79.6/100 80% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:00.326Ebackstab
[build]
Fluffy_Pillow 59.0/100 59% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:01.658Neviscerate
[finish]
Fluffy_Pillow 42.1/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:02.662Ebackstab
[build]
Fluffy_Pillow 61.5/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:03.667Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:05.987Ksecret_technique
[finish]
Fluffy_Pillow 31.3/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:06.992Rvanish
[stealth_cds]
Combo 3 47.7/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:06.992Dshadowstrike
[build]
Fluffy_Pillow 47.7/100 48% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:09.236Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:10.241Ebackstab
[build]
Fluffy_Pillow 51.6/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:11.998Neviscerate
[finish]
Fluffy_Pillow 35.6/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:13.002Ebackstab
[build]
Fluffy_Pillow 46.0/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:15.726Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
4:18.492Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
4:20.438Lrupture
[finish]
Fluffy_Pillow 30.4/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), flask_of_alchemical_chaos_haste
4:21.443Ebackstab
[build]
Fluffy_Pillow 51.8/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), flask_of_alchemical_chaos_haste
4:23.669Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
4:26.427Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
4:27.631Ebackstab
[build]
Fluffy_Pillow 74.1/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
4:28.636Ebackstab
[build]
Fluffy_Pillow 45.5/100 46% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
4:31.362Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
4:33.155Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 20.8/100 21% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
4:34.202Neviscerate
[finish]
Fluffy_Pillow 36.7/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:35.206Ebackstab
[build]
Fluffy_Pillow 47.1/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:37.816Ebackstab
[build]
Fluffy_Pillow 44.8/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:38.820Jflagellation
[cds]
Fluffy_Pillow 16.2/100 16% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:39.827Hsymbols_of_death
[cds]
Combo 3 31.6/100 32% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, flagellation_buff, deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:39.827Qshadow_dance
[stealth_cds]
Combo 3 71.6/100 72% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:39.827Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 71.6/100 72% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:39.827Ksecret_technique
[finish]
Fluffy_Pillow 71.6/100 72% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:40.831Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:41.834Ishadow_blades
[cds]
Combo 3 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:41.834Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:42.836Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:43.841Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(9), flagellation_buff(20), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:44.844Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_buff(27), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:45.848Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:46.854Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:47.858Ebackstab
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.863Lrupture
[finish]
Fluffy_Pillow 57.2/100 57% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:49.867Hsymbols_of_death
[cds]
Combo 3 78.6/100 79% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:49.867Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques(6), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:49.867Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(6), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:50.874Mcoup_de_grace
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(5), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:52.078Fcold_blood
[cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques, the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:52.078Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques, the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:53.081Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:54.084Neviscerate
[finish]
Fluffy_Pillow 82.4/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:55.088Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
4:56.093Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
4:57.098Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:58.102Ebackstab
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:59.107Ebackstab
[build]
Fluffy_Pillow 57.2/100 57% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
5:00.112Neviscerate
[finish]
Fluffy_Pillow 36.6/100 37% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
5:01.117Ebackstab
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
5:03.067Ebackstab
[build]
Fluffy_Pillow 49.2/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
5:05.436Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
5:06.442Hsymbols_of_death
[cds]
Combo 3 51.5/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
5:06.442Qshadow_dance
[stealth_cds]
Combo 3 91.5/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
5:06.442Dshadowstrike
[build]
Fluffy_Pillow 91.5/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
5:07.448Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
5:08.453Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
5:09.459Ksecret_technique
[finish]
Fluffy_Pillow 82.4/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(8), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
5:10.465Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
5:11.470Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
5:12.473Mcoup_de_grace
[finish]
Fluffy_Pillow 74.4/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
5:13.678Gpotion
[cds]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
5:13.678Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:14.683Neviscerate
[finish]
Fluffy_Pillow 74.8/100 75% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:15.688Ebackstab
[build]
Fluffy_Pillow 94.6/100 95% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
5:16.693Ebackstab
[build]
Fluffy_Pillow 73.9/100 74% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:17.696Lrupture
[finish]
Fluffy_Pillow 53.1/100 53% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:18.700Ebackstab
[build]
Fluffy_Pillow 82.4/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:19.705Neviscerate
[finish]
Fluffy_Pillow 53.7/100 54% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:20.711Ebackstab
[build]
Fluffy_Pillow 67.9/100 68% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:21.874Ebackstab
[build]
Fluffy_Pillow 45.0/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:24.393Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:27.025Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:28.030Ebackstab
[build]
Fluffy_Pillow 52.1/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:29.815Hsymbols_of_death
[cds]
Combo 3 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:30.022Ksecret_technique
[finish]
Fluffy_Pillow 83.6/100 84% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:31.027Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:32.033Neviscerate
[finish]
Fluffy_Pillow 79.8/100 80% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:33.037Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:33.037Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:34.041Mcoup_de_grace
[finish]
Fluffy_Pillow 66.8/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
5:35.246Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery, tempered_potion
5:36.249Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery, tempered_potion
5:37.254Dshadowstrike
[build]
Fluffy_Pillow 85.5/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery, tempered_potion
5:38.259Neviscerate
[finish]
Fluffy_Pillow 59.8/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery, tempered_potion
5:39.263Dshadowstrike
[build]
Fluffy_Pillow 79.1/100 79% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery, tempered_potion
5:40.268Neviscerate
[finish]
Fluffy_Pillow 53.3/100 53% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery, tempered_potion
5:41.273Ebackstab
[build]
Fluffy_Pillow 72.6/100 73% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery, tempered_potion
5:42.276Ebackstab
[build]
Fluffy_Pillow 51.9/100 52% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste2.35%2.79%1843
Versatility29.74%22.21%17321
Attack Power6162857457938
Mastery66.00%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Trinket2 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 3"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
trinket2=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 4 : 1,424,148 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,424,148.01,424,148.02,534.1 / 0.178%178,819.6 / 12.6%48,068.6
Resource Out In Waiting APM Active
Energy29.629.412.19%55.2100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 41,424,148
Auto Attack 0 (68,851)0.0% (4.8%)3.9122.30s5,264,3370

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 45,9643.2%347.61.00s39,67739,752Direct347.638,49077,35339,67519.3%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage347.63347.630.000.000.000.99810.000013,792,929.0717,999,076.5023.37%39,751.6039,751.60
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.23%223.3014929338,489.8324,21755,49438,507.7336,86340,4168,594,91611,216,71423.37%
crit19.33%67.203610277,353.2248,987110,99177,416.3971,68185,3715,198,0136,782,36223.36%
miss16.44%57.1432860.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 22,8871.6%347.11.00s19,78519,782Direct347.119,17138,59219,78519.3%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage347.13347.130.000.000.001.00020.00006,868,091.548,962,396.3423.37%19,782.1719,782.17
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.27%223.1015729819,170.5512,05127,88719,179.1918,38020,1634,277,1365,581,70223.37%
crit19.34%67.133910438,592.4823,89955,31538,619.4435,66942,7742,590,9563,380,69523.36%
miss16.39%56.8929940.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 31,2802.2%74.73.74s126,060125,496Direct74.776,268196,339126,04541.5%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.6874.680.000.000.001.00450.00009,414,322.4212,316,975.4723.57%125,495.85125,495.85
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.54%43.72236676,268.1160,160147,83576,287.1271,05380,4303,334,7304,365,30823.60%
crit41.46%30.961449196,338.73132,568375,160196,318.57178,204216,9346,079,5937,951,66823.56%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:74.68

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 85,577 (122,127)6.0% (8.6%)13.222.50s2,782,9232,310,550Direct39.4 (77.3)503,0431,012,825651,16029.0% (29.2%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.1639.410.000.000.001.20450.000025,667,250.1533,425,117.2723.21%2,310,550.392,310,550.39
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.95%27.961343503,043.42126,0731,764,633503,954.64341,876690,59514,071,60518,325,74623.22%
crit29.05%11.452221,012,824.52252,5253,240,9721,015,780.91530,7431,629,56011,595,64515,099,37223.22%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.16
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 36,5502.6%0.00.00s00Direct37.8223,492448,432289,46429.3%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0037.840.000.000.000.00000.000010,957,284.1210,957,284.120.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.66%26.741242223,491.9860,105765,561223,994.11158,970312,4275,977,8955,977,8950.00%
crit29.34%11.10320448,431.73114,6561,406,049449,748.43189,400859,9294,979,3894,979,3890.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,077)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,0771.4%22.412.91s269,6320Direct22.4269,7630269,7630.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.3922.370.000.000.000.00000.00006,035,869.996,035,869.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.371040269,763.30260,578315,100269,727.55262,516278,4386,035,8706,035,8700.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 243,661 (348,462)17.1% (24.5%)67.84.45s1,542,0481,535,142Direct67.8 (134.3)828,6991,687,0081,078,43129.1% (29.0%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.7767.770.000.000.001.00450.000073,074,124.9795,063,276.9223.13%1,535,141.711,535,141.71
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.89%48.043167828,698.73222,0092,265,971828,668.63696,0291,024,99339,808,33051,789,29123.13%
crit29.11%19.739331,687,008.48446,0314,197,7651,685,458.271,150,1512,406,28133,265,79543,273,98623.13%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:67.77

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 104,8017.4%66.54.53s472,6080Direct66.5363,798739,877472,68329.0%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage66.5166.510.000.000.000.00000.000031,432,182.1331,432,182.130.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.05%47.253068363,798.40105,841918,433363,664.45308,258425,67317,184,17117,184,1710.00%
crit28.95%19.26634739,877.46212,0001,969,067740,767.33499,3141,016,42314,248,01214,248,0120.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,084 (18,433)0.1% (1.3%)3.791.38s1,487,6711,481,361Direct3.7 (27.4)73,145145,91787,24219.4% (20.0%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.723.720.000.000.001.00450.0000324,780.84324,780.840.00%1,481,360.781,481,360.78
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.56%3.000473,144.6464,146120,25372,702.23093,678219,243219,2430.00%
crit19.44%0.7204145,917.19128,483235,83878,832.900227,377105,538105,5380.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 17,3491.2%0.00.00s00Direct23.7183,341364,427219,69420.1%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.710.000.000.000.00000.00005,209,583.035,209,583.030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.94%18.95927183,340.5183,825378,082183,284.56156,289214,9413,474,6823,474,6820.00%
crit20.06%4.76012364,427.29167,902760,202361,448.600675,0651,734,9011,734,9010.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,0020.8%0.00.00s00Direct279.410,78121,66812,88819.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00279.400.000.000.000.00000.00003,601,156.853,601,156.850.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.64%225.3115730510,780.607,91115,12510,785.5110,26111,3112,429,0122,429,0120.00%
crit19.36%54.10268321,668.1315,84630,29621,679.1019,73123,7371,172,1451,172,1450.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Phantom Reaping 19,798 (23,126)1.4% (1.6%)18.615.60s374,4280Direct18.6 (31.2)268,641538,487320,46319.2% (19.3%)0.0%

Stats Details: Phantom Reaping

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage18.5818.580.000.000.000.00000.00005,954,146.415,954,146.410.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.80%15.01431268,640.98259,030312,766268,674.23259,576280,8844,033,3394,033,3390.00%
crit19.20%3.57011538,486.70518,836617,806525,503.260598,1921,920,8071,920,8070.00%

Action Details: Phantom Reaping

  • id:448669
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:201465.44
  • base_dd_max:201465.44
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:448669
  • name:Phantom Reaping
  • school:shadow
  • tooltip:
  • description:{$@spelldesc444067=Your abilities have a high chance to summon a phantom ethereal, dealing {$=}{{$=}<rolemult>*{$s1=67342}} Shadow damage to your target and {$=}{{$=}<rolemult>*{$s1=67342}*({$s5=9}/100)} Shadow damage to all other enemies caught in its path. If the target is below {$s2=35}% health, this effect summons two additional phantoms at {$s3=25}% effectiveness.}
    Phantom Reaping (Echo) 3,3280.2%12.66.75s79,3650Direct12.666,345133,02079,36119.5%0.0%

Stats Details: Phantom Reaping Echo

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage12.6312.630.000.000.000.00000.00001,002,528.801,002,528.800.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.49%10.1722666,344.9064,75774,62566,337.0464,75772,876674,629674,6290.00%
crit19.51%2.46010133,019.99129,708147,132119,378.200145,951327,900327,9000.00%

Action Details: Phantom Reaping Echo

  • id:448669
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:50366.36
  • base_dd_max:50366.36
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:448669
  • name:Phantom Reaping
  • school:shadow
  • tooltip:
  • description:{$@spelldesc444067=Your abilities have a high chance to summon a phantom ethereal, dealing {$=}{{$=}<rolemult>*{$s1=67342}} Shadow damage to your target and {$=}{{$=}<rolemult>*{$s1=67342}*({$s5=9}/100)} Shadow damage to all other enemies caught in its path. If the target is below {$s2=35}% health, this effect summons two additional phantoms at {$s3=25}% effectiveness.}
Rupture 95,154 (112,617)6.7% (7.9%)9.631.35s3,534,5033,519,038Periodic164.1 (328.3)133,376276,242173,99428.4% (28.4%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.560.00164.14164.147.071.00451.776728,556,945.0728,556,945.070.00%112,195.383,519,037.78
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.57%117.4786155133,376.09322368,218133,429.32119,978148,38715,665,18115,665,1810.00%
crit28.43%46.672575276,242.07355714,070276,601.94226,621336,53312,891,76412,891,7640.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.56
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 17,4631.2%164.11.80s31,9230Periodic164.124,53950,61831,92228.3%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage164.140.000.00164.140.000.00000.00005,239,893.735,239,893.730.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.67%117.648115424,538.6610,18267,51724,548.6922,10727,9082,886,4372,886,4370.00%
crit28.33%46.50257250,618.0220,395132,17350,677.9339,52763,7292,353,4572,353,4570.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (250,987)0.0% (17.6%)15.919.09s4,723,3724,702,437

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.950.000.000.000.001.00450.00000.000.000.00%4,702,436.514,702,436.51

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.95
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 64,4484.5%0.00.00s00Direct15.9679,0871,899,4611,213,40843.8%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.950.000.000.000.00000.000019,343,441.1225,220,340.1023.30%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.23%8.97314679,086.82158,5781,450,747679,697.91449,428921,1896,087,2097,954,10323.47%
crit43.77%6.983141,899,460.59319,6193,529,7751,928,207.171,215,6922,850,33913,256,23317,266,23723.22%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 186,53813.1%0.00.00s00Direct31.8985,6462,733,4631,761,70344.4%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.780.000.000.000.00000.000055,975,484.4855,975,484.480.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.60%17.671027985,645.82234,0432,097,953987,235.15755,0231,240,99917,410,79417,410,7940.00%
crit44.40%14.117242,733,463.25467,3715,104,4742,753,517.161,936,7313,795,70538,564,69138,564,6910.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (92,718)0.0% (6.5%)3.690.96s7,648,7450

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.640.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.64
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 92,7186.5%380.51.21s73,1570Periodic380.573,150073,1500.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage380.520.000.00380.520.000.00000.000027,837,940.1227,837,940.120.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%380.5227946173,150.31112952,05373,210.0261,60487,06627,837,94027,837,9400.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14698.68
  • base_dd_max:14698.68
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 112,6097.9%52.35.84s644,941642,054Direct52.3280,819873,892644,90661.4%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2752.270.000.000.001.00450.000033,711,057.9043,960,278.2423.31%642,054.24642,054.24
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.61%20.181131280,818.60137,147356,787280,780.88255,613305,3585,666,8737,383,62523.25%
crit61.39%32.092144873,891.97302,2171,203,732874,740.92783,990932,60028,044,18536,576,65323.33%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.26

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,5220.2%2.273.54s484,0520Direct2.2400,401802,660484,60420.9%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.182.180.000.000.000.00000.00001,056,449.161,056,449.160.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.07%1.7207400,400.58377,346490,592331,625.280467,264690,176690,1760.00%
crit20.93%0.4604802,660.11755,824949,931293,597.310949,931366,273366,2730.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8290.1%2.375.72s109,9980Direct2.391,307184,497110,00120.0%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.262.260.000.000.000.00000.0000248,770.87248,770.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.96%1.810791,306.6083,958119,92877,896.410113,663165,096165,0960.00%
crit20.04%0.4504184,497.47168,168236,31065,516.650236,31083,67583,6750.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:71598.20
  • base_dd_max:71598.20
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 46,1893.2%18.715.68s740,8970Periodic106.1130,8280130,8280.0%0.0%70.6%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage18.730.00106.05106.0511.750.00002.000013,875,338.0913,875,338.090.00%65,416.070.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%106.0566162130,827.9760,995221,273129,861.1872,054173,55413,875,33813,875,3380.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 72,1435.1%36.57.93s593,2890Direct36.5497,041996,632593,24619.3%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage36.5136.510.000.000.000.00000.000021,662,510.9721,662,510.970.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.73%29.48754497,040.90453,001846,214496,863.41467,500548,15314,652,12714,652,1270.00%
crit19.27%7.03018996,631.50907,3601,726,333996,297.9701,272,8747,010,3847,010,3840.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,2300.3%2.274.72s569,6860Direct2.2480,936965,765569,81918.3%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.232.230.000.000.000.00000.00001,268,904.761,268,904.760.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.70%1.8208480,936.02452,539567,086407,096.020567,086875,301875,3010.00%
crit18.30%0.4105965,764.64906,4361,140,801320,888.1401,140,801393,604393,6040.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 83,9485.9%57.75.17s436,4180Direct57.7364,281731,514436,38619.6%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.7257.720.000.000.000.00000.000025,191,800.4532,913,685.8023.46%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.35%46.382567364,280.71232,502488,478364,517.36339,316387,81716,896,57122,076,35023.46%
crit19.65%11.34223731,513.83465,701979,869732,230.70552,227857,9598,295,22910,837,33623.46%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 4
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.78s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 24.811.62s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage24.780.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.271.14s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.230.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.274.51s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.200.0064.530.000.260.00000.83400.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5307.55s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 99.03.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.960.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.372.10s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.330.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.34s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [O]:13.25
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.375.72s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.262.260.000.000.000.00000.00000.001,551,012.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.26090.00000.000001,551,01290.27%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8290.1%2.375.72s109,9980Direct2.391,307184,497110,00120.0%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.262.260.000.000.000.00000.0000248,770.87248,770.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.96%1.810791,306.6083,958119,92877,896.410113,663165,096165,0960.00%
crit20.04%0.4504184,497.47168,168236,31065,516.650236,31083,67583,6750.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:71598.20
  • base_dd_max:71598.20
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.40s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.30
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.30s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [P]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.372.01s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1579.6183.6s0.5s275.8s99.94%100.00%569.9 (569.9)0.1

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.3s / 326.4s
  • trigger_min/max:0.0s / 4.3s
  • trigger_pct:100.00%
  • duration_min/max:3.0s / 359.9s
  • uptime_min/max:99.04% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.24%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.16%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.16%
  • acrobatic_strikes_10:98.28%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.481.7116.5s3.6s124.1s97.23%0.00%73.1 (75.9)1.4

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 335.3s
  • trigger_min/max:1.0s / 46.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 356.9s
  • uptime_min/max:84.39% / 99.44%

Stack Uptimes

  • alacrity_1:3.18%
  • alacrity_2:2.34%
  • alacrity_3:1.86%
  • alacrity_4:1.67%
  • alacrity_5:88.18%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.50%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.64%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows15.90.019.1s19.1s6.9s36.79%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 55.5s
  • trigger_min/max:9.2s / 55.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.97% / 39.88%

Stack Uptimes

  • bolstering_shadows_1:36.79%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.1s0.00%1.43%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:82.0s / 100.3s
  • trigger_min/max:82.0s / 100.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.08%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Danse Macabre13.347.823.3s23.3s8.2s36.27%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 73.7s
  • trigger_min/max:8.0s / 73.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.01% / 38.85%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.52%
  • danse_macabre_3:6.60%
  • danse_macabre_4:16.48%
  • danse_macabre_5:8.63%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.773.240.3s3.7s34.9s89.58%95.43%73.2 (73.2)6.7

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 167.6s
  • trigger_min/max:1.0s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 151.5s
  • uptime_min/max:77.16% / 95.80%

Stack Uptimes

  • deeper_daggers_1:89.58%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes15.90.019.1s19.1s3.4s18.24%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 55.5s
  • trigger_min/max:9.2s / 55.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.14% / 21.21%

Stack Uptimes

  • disorienting_strikes_1:12.14%
  • disorienting_strikes_2:6.10%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.043.722.3s5.2s17.5s81.72%0.00%3.2 (3.2)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.0s / 62.3s
  • trigger_min/max:1.0s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.1s
  • uptime_min/max:67.04% / 93.36%

Stack Uptimes

  • escalating_blade_1:24.88%
  • escalating_blade_2:22.04%
  • escalating_blade_3:22.64%
  • escalating_blade_4:12.16%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Fathomdweller's Runed Citrine (_proc)2.00.283.4s72.3s15.3s10.18%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4522.43

Trigger Details

  • interval_min/max:15.1s / 345.1s
  • trigger_min/max:1.0s / 345.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 43.1s
  • uptime_min/max:0.00% / 37.82%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.19%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.723.991.3s9.8s11.8s14.65%0.00%14.1 (94.8)3.6

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.3s
  • trigger_min/max:1.0s / 88.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.85% / 16.89%

Stack Uptimes

  • flagellation_buff_1:1.34%
  • flagellation_buff_7:0.04%
  • flagellation_buff_8:0.78%
  • flagellation_buff_9:0.59%
  • flagellation_buff_10:0.53%
  • flagellation_buff_11:0.48%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.03%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.71%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.03%
  • flagellation_buff_18:0.06%
  • flagellation_buff_19:0.42%
  • flagellation_buff_20:0.39%
  • flagellation_buff_21:0.33%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.19%
  • flagellation_buff_25:0.84%
  • flagellation_buff_26:0.37%
  • flagellation_buff_27:0.21%
  • flagellation_buff_28:0.22%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.03%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.23%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.0s / 98.3s
  • trigger_min/max:78.0s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.33% / 16.23%

Stack Uptimes

  • flagellation_persist_1:0.00%
  • flagellation_persist_13:0.01%
  • flagellation_persist_23:0.00%
  • flagellation_persist_30:14.22%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.20.6111.7s77.3s35.1s25.17%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.4s / 327.7s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 65.38%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.17%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.20.6112.8s78.2s34.7s24.93%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 312.2s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 74.42%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.93%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.1s76.7s35.6s24.86%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 340.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 83.02%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.86%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6112.1s76.8s35.3s25.04%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:31.8s / 341.5s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 77.48%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.04%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form86.80.039.5s3.4s58.0s95.27%100.00%0.0 (0.0)4.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.88%
  • flawless_form_2:8.78%
  • flawless_form_3:11.87%
  • flawless_form_4:9.79%
  • flawless_form_5:2.72%
  • flawless_form_6:4.63%
  • flawless_form_7:5.91%
  • flawless_form_8:11.19%
  • flawless_form_9:18.28%
  • flawless_form_10:8.60%
  • flawless_form_11:1.32%
  • flawless_form_12:0.06%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.14%
  • flawless_form_16:0.08%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.286.9s73.8s16.7s10.66%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.7s / 305.0s
  • trigger_min/max:0.2s / 305.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 49.7s
  • uptime_min/max:0.00% / 42.95%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.66%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.287.2s72.9s16.9s10.86%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.2s / 317.3s
  • trigger_min/max:0.1s / 317.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 52.5s
  • uptime_min/max:0.00% / 49.46%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.86%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)2.00.288.1s74.9s16.7s10.86%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.2s / 341.7s
  • trigger_min/max:0.3s / 341.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 49.6s
  • uptime_min/max:0.00% / 43.19%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.86%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.289.0s75.3s17.0s11.02%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.5s / 326.8s
  • trigger_min/max:0.2s / 326.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 52.7s
  • uptime_min/max:0.00% / 44.07%

Stack Uptimes

  • nascent_empowerment_Vers_1:11.02%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.90.422.0s21.3s3.7s17.23%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.3s
  • trigger_min/max:1.0s / 68.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.1s
  • uptime_min/max:8.81% / 27.01%

Stack Uptimes

  • poised_shadows_1:17.23%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.018.0s18.9s1.1s2.57%11.24%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.5s
  • trigger_min/max:1.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.73% / 4.62%

Stack Uptimes

  • premeditation_1:2.57%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.284.8s71.5s15.4s10.86%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:24772.46

Trigger Details

  • interval_min/max:15.0s / 303.1s
  • trigger_min/max:1.0s / 303.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.0s
  • uptime_min/max:0.00% / 33.63%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.86%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.60.090.9s90.9s15.8s19.18%17.32%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 100.2s
  • trigger_min/max:90.0s / 100.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 16.0s
  • uptime_min/max:16.71% / 21.88%

Stack Uptimes

  • shadow_blades_1:19.18%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.3s23.3s8.2s36.27%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 73.7s
  • trigger_min/max:8.0s / 73.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.01% / 38.85%

Stack Uptimes

  • shadow_dance_1:36.27%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques67.5135.14.4s1.5s3.5s78.90%95.33%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 43.0s
  • trigger_min/max:0.5s / 6.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.9s
  • uptime_min/max:71.22% / 85.65%

Stack Uptimes

  • shadow_techniques_1:20.51%
  • shadow_techniques_2:21.11%
  • shadow_techniques_3:9.39%
  • shadow_techniques_4:10.47%
  • shadow_techniques_5:5.97%
  • shadow_techniques_6:5.69%
  • shadow_techniques_7:2.52%
  • shadow_techniques_8:2.25%
  • shadow_techniques_9:0.50%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s298.3s99.32%87.69%99.0 (99.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.3s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.40.0110.8s101.2s9.9s1.20%0.00%0.0 (0.0)0.3

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:4.0s / 284.1s
  • trigger_min/max:2.3s / 284.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.8s
  • uptime_min/max:0.00% / 11.58%

Stack Uptimes

  • storm_sewers_citrine_1:1.20%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0103.5s91.9s9.9s1.41%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:12.2s / 317.7s
  • trigger_min/max:1.0s / 280.1s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 22.3s
  • uptime_min/max:0.00% / 12.60%

Stack Uptimes

  • storm_sewers_citrine_1:1.41%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0120.7s107.8s9.9s1.25%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.5s / 337.9s
  • trigger_min/max:2.0s / 308.4s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 19.1s
  • uptime_min/max:0.00% / 10.88%

Stack Uptimes

  • storm_sewers_citrine_1:1.25%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0103.5s97.3s9.8s1.28%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:7.0s / 284.9s
  • trigger_min/max:0.9s / 284.9s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 17.0s
  • uptime_min/max:0.00% / 11.96%

Stack Uptimes

  • storm_sewers_citrine_1:1.28%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0106.5s97.8s9.9s1.37%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.2s / 244.9s
  • trigger_min/max:2.0s / 244.9s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 16.1s
  • uptime_min/max:0.00% / 11.37%

Stack Uptimes

  • storm_sewers_citrine_1:1.37%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.00.285.0s71.7s15.4s10.38%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1439.42
  • stat:haste_rating
  • amount:1439.42
  • stat:mastery_rating
  • amount:1439.42
  • stat:versatility_rating
  • amount:1439.42

Trigger Details

  • interval_min/max:15.3s / 295.1s
  • trigger_min/max:0.9s / 295.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.5s
  • uptime_min/max:0.00% / 36.33%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.38%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.3s21.3s2.3s11.05%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.1s / 68.0s
  • trigger_min/max:3.1s / 68.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s
  • uptime_min/max:9.08% / 14.31%

Stack Uptimes

  • supercharge_1_1:11.05%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.02%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 68.0s
  • trigger_min/max:1.0s / 68.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.5s
  • uptime_min/max:0.59% / 6.15%

Stack Uptimes

  • supercharge_2_1:2.02%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.4s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 3.0s
  • uptime_min/max:0.00% / 1.02%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 1.0s
  • uptime_min/max:0.00% / 0.34%

Stack Uptimes

  • supercharge_4_1:0.00%

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.2s21.3s24.4s61.09%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.3s / 98.9s
  • trigger_min/max:1.0s / 68.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:55.23% / 65.36%

Stack Uptimes

  • symbols_of_death_1:61.09%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.9s307.9s27.4s13.34%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.3s
  • trigger_min/max:300.0s / 329.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.96% / 18.12%

Stack Uptimes

  • tempered_potion_1:13.34%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.82%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.4s21.3s2.9s13.68%22.43%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:4.0s / 68.0s
  • trigger_min/max:1.0s / 68.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:11.29% / 16.38%

Stack Uptimes

  • the_rotten_1:10.63%
  • the_rotten_2:3.05%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.5s122.5s0.1s0.09%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.7s
  • trigger_min/max:120.0s / 136.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.50%

Stack Uptimes

  • vanish_1:0.09%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.0110.5s55.7s15.0s0.47%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4752.44

Trigger Details

  • interval_min/max:35.5s / 267.7s
  • trigger_min/max:2.0s / 267.7s
  • trigger_pct:100.00%
  • duration_min/max:2.6s / 33.8s
  • uptime_min/max:0.00% / 19.39%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.51%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.00.284.2s70.9s15.4s10.15%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5499.44

Trigger Details

  • interval_min/max:15.0s / 331.0s
  • trigger_min/max:1.0s / 329.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 50.4s
  • uptime_min/max:0.00% / 35.61%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.15%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)48.227.075.06.1s0.7s74.5s
Skyfury (Off Hand)48.225.076.06.1s0.7s64.1s
Supercharger secret_technique12.48.016.023.8s9.2s92.0s
Cold Blood secret_technique3.63.04.090.7s82.0s100.5s
Supercharger rupture0.30.03.0146.5s36.4s273.9s
Supercharger coup_de_grace2.60.07.080.6s10.2s342.5s
Supercharger eviscerate13.27.021.022.8s1.0s138.7s
CP Spent During Flagellation200.8142.0249.011.3s1.0s90.7s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap8.76%5.88%13.29%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 4
Energy RegenEnergy1,443.863,003.5934.00%2.08367.0110.89%
Improved AmbushCombo Points52.2633.354.60%0.6418.9136.18%
PremeditationCombo Points17.1656.827.84%3.3163.3152.70%
Relentless StrikesEnergy106.444,244.8848.05%39.88115.342.65%
Shadow BladesCombo Points22.01114.3515.78%5.1917.7213.42%
Shadow TechniquesEnergy352.801,219.3513.80%3.46191.8513.59%
Shadow TechniquesCombo Points84.65237.5732.78%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points14.83103.8014.32%7.000.000.00%
BackstabCombo Points74.6874.3010.25%0.990.380.51%
ShadowstrikeCombo Points52.26104.4914.42%2.000.040.04%
Symbols of DeathEnergy14.29367.084.15%25.68204.6535.79%
Usage Type Count Total Tot% Avg RPE APR
Combo 4
BackstabEnergy74.682,987.1333.60%40.0040.003,151.63
Coup de GraceEnergy13.16460.595.18%35.0035.0079,516.29
Coup de GraceCombo Points13.1689.8912.47%6.836.83407,433.94
EviscerateEnergy67.772,372.0326.68%35.0035.0044,057.66
EviscerateCombo Points67.77461.0763.96%6.806.80226,661.09
RuptureEnergy9.56239.092.69%25.0025.00141,354.99
RuptureCombo Points9.5665.369.07%6.836.84517,091.79
Secret TechniqueEnergy15.95478.395.38%30.0030.00157,440.91
Secret TechniqueCombo Points15.95104.5114.50%6.556.55720,716.29
ShadowstrikeEnergy52.262,351.9026.46%45.0045.0014,333.53
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.4229.60878.445.90.0100.0
Combo Points0.02.412.40100.33.90.07.0

Statistics & Data Analysis

Fight Length
Combo 4 Fight Length
Count 1315
Mean 300.36
Minimum 240.36
Maximum 359.90
Spread ( max - min ) 119.55
Range [ ( max - min ) / 2 * 100% ] 19.90%
DPS
Combo 4 Damage Per Second
Count 1315
Mean 1424147.95
Minimum 1283111.88
Maximum 1568543.58
Spread ( max - min ) 285431.70
Range [ ( max - min ) / 2 * 100% ] 10.02%
Standard Deviation 46885.5393
5th Percentile 1348830.74
95th Percentile 1500592.84
( 95th Percentile - 5th Percentile ) 151762.10
Mean Distribution
Standard Deviation 1292.9331
95.00% Confidence Interval ( 1421613.85 - 1426682.06 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4164
0.1 Scale Factor Error with Delta=300 18765559
0.05 Scale Factor Error with Delta=300 75062236
0.01 Scale Factor Error with Delta=300 1876555876
Priority Target DPS
Combo 4 Priority Target Damage Per Second
Count 1315
Mean 1424147.95
Minimum 1283111.88
Maximum 1568543.58
Spread ( max - min ) 285431.70
Range [ ( max - min ) / 2 * 100% ] 10.02%
Standard Deviation 46885.5393
5th Percentile 1348830.74
95th Percentile 1500592.84
( 95th Percentile - 5th Percentile ) 151762.10
Mean Distribution
Standard Deviation 1292.9331
95.00% Confidence Interval ( 1421613.85 - 1426682.06 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4164
0.1 Scale Factor Error with Delta=300 18765559
0.05 Scale Factor Error with Delta=300 75062236
0.01 Scale Factor Error with Delta=300 1876555876
DPS(e)
Combo 4 Damage Per Second (Effective)
Count 1315
Mean 1424147.95
Minimum 1283111.88
Maximum 1568543.58
Spread ( max - min ) 285431.70
Range [ ( max - min ) / 2 * 100% ] 10.02%
Damage
Combo 4 Damage
Count 1315
Mean 427302787.02
Minimum 331972910.72
Maximum 517054734.41
Spread ( max - min ) 185081823.69
Range [ ( max - min ) / 2 * 100% ] 21.66%
DTPS
Combo 4 Damage Taken Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 4 Healing Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 4 Healing Per Second (Effective)
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 4 Heal
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 4 Healing Taken Per Second
Count 1315
Mean 2801.04
Minimum 0.00
Maximum 8594.34
Spread ( max - min ) 8594.34
Range [ ( max - min ) / 2 * 100% ] 153.41%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.26 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 74.68 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.30 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.64 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.95 secret_technique,if=variable.secret
L 9.56 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.16 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 67.77 eviscerate
actions.stealth_cds
# count action,conditions
O 13.25 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
P 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0235DGJNPDLHODIKDNNDNDNHNDMOFKDNDNNDNENEHONDKDMDNNEELEENHODNDKDMDDNENENEEHLEKEENEEMENENEEENEENEEJHOKDNNIDMDNENNODFKHNDNNDNELEMEENEEENPDNHODKDNDNDMEELEENEEKEEEMEENEEELEEJHOKDNDINDMNENHONDFKDNNDNLENENHODKDMDNDNENEEENEENEHOKDMDNDNDLEENEEKPDNEEMEEELEEEJHONDKDINDMDNNEHONDFKNDNNDNELEEMEEENHODKDNDMDDGNEENEEKEELHENODNDNDDNNE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre3trinket_sync_slot
[precombat]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:01.004Gpotion
[cds]
Fluffy_Pillow 68.1/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance
0:01.004Jflagellation
[cds]
Fluffy_Pillow 68.1/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, tempered_potion
0:02.007Neviscerate
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, the_first_dance, flagellation_buff, tempered_potion
0:03.011Pvanish
[stealth_cds]
Combo 4 99.6/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, tempered_potion
0:03.011Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(6), alacrity, flawless_form, premeditation, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, tempered_potion
0:04.017Lrupture
[finish]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(9), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, tempered_potion
0:05.021Hsymbols_of_death
[cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, tempered_potion
0:05.021Oshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, tempered_potion
0:05.021Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, tempered_potion
0:06.027Ishadow_blades
[cds]
Combo 4 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, tempered_potion
0:06.027Ksecret_technique
[finish]
Fluffy_Pillow 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, tempered_potion
0:07.033Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, tempered_potion
0:08.037Neviscerate
[finish]
Fluffy_Pillow 69.4/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(7), flagellation_buff(25), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:09.040Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:10.044Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:11.049Neviscerate
[finish]
Fluffy_Pillow 78.1/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:12.052Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:13.054Neviscerate
[finish]
Fluffy_Pillow 78.1/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(10), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
0:14.059Hsymbols_of_death
[cds]
Combo 4 93.2/100 93% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
0:14.059Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:15.063Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:16.068Mcoup_de_grace
[finish]
Fluffy_Pillow 78.1/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(4), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:17.271Oshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:17.271Fcold_blood
[cds]
Combo 4 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:17.271Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(9), premeditation, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:18.276Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), premeditation, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:19.280Neviscerate
[finish]
Fluffy_Pillow 70.1/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:20.284Dshadowstrike
[build]
Fluffy_Pillow 93.2/100 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:21.290Neviscerate
[finish]
Fluffy_Pillow 71.3/100 71% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:22.295Neviscerate
[finish]
Fluffy_Pillow 94.4/100 94% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:23.300Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:24.305Neviscerate
[finish]
Fluffy_Pillow 78.1/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:25.308Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(7), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:26.313Neviscerate
[finish]
Fluffy_Pillow 75.1/100 75% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:27.319Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:28.325Hsymbols_of_death
[cds]
Combo 4 83.1/100 83% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:28.325Oshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:28.325Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
6.0/7 86% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:29.328Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:30.332Ksecret_technique
[finish]
Fluffy_Pillow 78.1/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:31.338Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
0:32.343Mcoup_de_grace
[finish]
Fluffy_Pillow 77.5/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
0:33.547Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(8), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
0:34.551Neviscerate
[finish]
Fluffy_Pillow 85.5/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
0:35.556Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
0:36.560Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
0:37.564Ebackstab
[build]
Fluffy_Pillow 90.5/100 91% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:38.569Lrupture
[finish]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:39.572Ebackstab
[build]
Fluffy_Pillow 96.1/100 96% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:40.576Ebackstab
[build]
Fluffy_Pillow 76.1/100 76% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:41.581Neviscerate
[finish]
Fluffy_Pillow 46.7/100 47% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:42.586Hsymbols_of_death
[cds]
Combo 4 52.4/100 52% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:42.586Oshadow_dance
[stealth_cds]
Combo 4 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), the_rotten(2), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:42.586Dshadowstrike
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), premeditation, the_rotten(2), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:43.590Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(7), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:44.596Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:45.600Ksecret_technique
[finish]
Fluffy_Pillow 73.2/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:46.605Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:47.607Mcoup_de_grace
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_vers
0:48.810Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:49.816Dshadowstrike
[build]
Fluffy_Pillow 73.6/100 74% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:50.820Neviscerate
[finish]
Fluffy_Pillow 47.3/100 47% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:51.825Ebackstab
[build]
Fluffy_Pillow 73.9/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:52.830Neviscerate
[finish]
Fluffy_Pillow 52.5/100 53% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:53.835Ebackstab
[build]
Fluffy_Pillow 71.1/100 71% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
0:54.840Neviscerate
[finish]
Fluffy_Pillow 49.8/100 50% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:55.844Ebackstab
[build]
Fluffy_Pillow 68.4/100 68% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:56.849Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:58.682Hsymbols_of_death
[cds]
Combo 4 26.4/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
0:58.682Lrupture
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
0:59.686Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:00.690Ksecret_technique
[finish]
Fluffy_Pillow 78.6/100 79% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:01.694Ebackstab
[build]
Fluffy_Pillow 94.2/100 94% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
1:02.699Ebackstab
[build]
Fluffy_Pillow 72.9/100 73% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:03.703Neviscerate
[finish]
Fluffy_Pillow 51.5/100 51% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), bolstering_shadows, flask_of_alchemical_chaos_vers
1:04.708Ebackstab
[build]
Fluffy_Pillow 65.1/100 65% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:05.714Ebackstab
[build]
Fluffy_Pillow 51.7/100 52% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:07.253Mcoup_de_grace
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:08.456Ebackstab
[build]
Fluffy_Pillow 82.2/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:09.462Neviscerate
[finish]
Fluffy_Pillow 61.4/100 61% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:10.465Ebackstab
[build]
Fluffy_Pillow 80.6/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:11.468Neviscerate
[finish]
Fluffy_Pillow 59.8/100 60% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:12.474Ebackstab
[build]
Fluffy_Pillow 66.0/100 66% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:13.478Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:16.723Ebackstab
[build]
Fluffy_Pillow 45.3/100 45% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:19.482Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:20.485Ebackstab
[build]
Fluffy_Pillow 51.2/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:22.827Ebackstab
[build]
Fluffy_Pillow 45.3/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:25.270Neviscerate
[finish]
Fluffy_Pillow 36.5/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:26.272Ebackstab
[build]
Fluffy_Pillow 46.6/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:29.059Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:30.956Jflagellation
[cds]
Fluffy_Pillow 30.8/100 31% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:32.007Hsymbols_of_death
[cds]
Combo 4 42.5/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), flagellation_buff, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:32.007Oshadow_dance
[stealth_cds]
Combo 4 82.5/100 82% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:32.007Ksecret_technique
[finish]
Fluffy_Pillow 82.5/100 82% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:33.012Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(6), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:34.017Neviscerate
[finish]
Fluffy_Pillow 74.2/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(8), the_rotten, flagellation_buff(9), bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:35.022Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:36.028Ishadow_blades
[cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(26), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:36.028Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(26), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:37.033Mcoup_de_grace
[finish]
Fluffy_Pillow 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), flagellation_buff(26), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:38.238Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
1:39.241Neviscerate
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:40.245Ebackstab
[build]
Fluffy_Pillow 84.2/100 84% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(7), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:41.250Neviscerate
[finish]
Fluffy_Pillow 62.8/100 63% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(9), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:42.254Neviscerate
[finish]
Fluffy_Pillow 81.5/100 81% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:43.258Oshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:43.258Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), premeditation, shadow_techniques(8), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:44.264Fcold_blood
[cds]
Combo 4 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:44.264Ksecret_technique
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:45.268Hsymbols_of_death
[cds]
Combo 4 89.3/100 89% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:45.268Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:46.272Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:47.276Neviscerate
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:48.279Neviscerate
[finish]
Fluffy_Pillow 99.2/100 99% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
1:49.285Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
1:50.290Neviscerate
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
1:51.296Ebackstab
[build]
Fluffy_Pillow 84.3/100 84% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
1:52.302Lrupture
[finish]
Fluffy_Pillow 62.9/100 63% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
1:53.308Ebackstab
[build]
Fluffy_Pillow 83.5/100 84% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
1:54.312Mcoup_de_grace
[finish]
Fluffy_Pillow 62.1/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
1:55.515Ebackstab
[build]
Fluffy_Pillow 99.9/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
1:56.519Ebackstab
[build]
Fluffy_Pillow 78.5/100 78% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
1:57.524Neviscerate
[finish]
Fluffy_Pillow 57.1/100 57% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
1:58.529Ebackstab
[build]
Fluffy_Pillow 62.7/100 63% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:59.833Ebackstab
[build]
Fluffy_Pillow 40.5/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:03.313Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:06.218Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, poised_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:07.223Pvanish
[stealth_cds]
Combo 4 50.7/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:07.223Dshadowstrike
[build]
Fluffy_Pillow 50.7/100 51% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:09.715Neviscerate
[finish]
Fluffy_Pillow 35.9/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:10.720Hsymbols_of_death
[cds]
Combo 4 46.5/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:10.720Oshadow_dance
[stealth_cds]
Combo 4 86.5/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:10.720Dshadowstrike
[build]
Fluffy_Pillow 86.5/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:11.723Ksecret_technique
[finish]
Fluffy_Pillow 60.0/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:12.728Dshadowstrike
[build]
Fluffy_Pillow 98.6/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
2:13.731Neviscerate
[finish]
Fluffy_Pillow 72.2/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:14.736Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:15.742Neviscerate
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:16.746Dshadowstrike
[build]
Fluffy_Pillow 76.2/100 76% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:17.750Mcoup_de_grace
[finish]
Fluffy_Pillow 49.7/100 50% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:18.957Ebackstab
[build]
Fluffy_Pillow 90.4/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
2:19.963Ebackstab
[build]
Fluffy_Pillow 61.0/100 61% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_vers
2:20.967Lrupture
[finish]
Fluffy_Pillow 39.6/100 40% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:21.971Ebackstab
[build]
Fluffy_Pillow 55.2/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:23.675Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:25.862Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), flask_of_alchemical_chaos_vers
2:26.866Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
2:29.771Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:32.123Ksecret_technique
[finish]
Fluffy_Pillow 31.0/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:33.128Ebackstab
[build]
Fluffy_Pillow 46.6/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(4), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:35.644Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(2), bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:38.600Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:41.213Mcoup_de_grace
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:42.418Ebackstab
[build]
Fluffy_Pillow 73.4/100 73% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:43.425Ebackstab
[build]
Fluffy_Pillow 48.0/100 48% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:45.684Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:46.691Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:50.083Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:53.067Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:55.128Lrupture
[finish]
Fluffy_Pillow 30.2/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:56.132Ebackstab
[build]
Fluffy_Pillow 50.7/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:58.636Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:00.788Jflagellation
[cds]
Fluffy_Pillow 27.7/100 28% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, shadow_techniques, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:02.009Hsymbols_of_death
[cds]
Combo 4 43.9/100 44% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, shadow_techniques(2), flagellation_buff, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:02.009Oshadow_dance
[stealth_cds]
Combo 4 83.9/100 84% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:02.009Ksecret_technique
[finish]
Fluffy_Pillow 83.9/100 84% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:03.016Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(9), poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:04.020Neviscerate
[finish]
Fluffy_Pillow 73.2/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(9), bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:05.024Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(8), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:06.030Ishadow_blades
[cds]
Combo 4 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(19), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:06.030Neviscerate
[finish]
Fluffy_Pillow 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(19), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
3:07.033Dshadowstrike
[build]
Fluffy_Pillow 92.2/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_buff(26), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:08.036Mcoup_de_grace
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_buff(26), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:09.243Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:10.248Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:11.255Neviscerate
[finish]
Fluffy_Pillow 79.0/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(9), shadow_techniques(9), flagellation_buff(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:12.262Hsymbols_of_death
[cds]
Combo 4 98.2/100 98% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:12.262Oshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:12.262Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:13.266Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:14.269Fcold_blood
[cds]
Combo 4 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:14.269Ksecret_technique
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(8), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:15.273Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:16.276Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:17.280Neviscerate
[finish]
Fluffy_Pillow 93.2/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:18.284Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:19.288Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:20.294Lrupture
[finish]
Fluffy_Pillow 85.2/100 85% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:21.298Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:22.302Neviscerate
[finish]
Fluffy_Pillow 71.1/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:23.308Ebackstab
[build]
Fluffy_Pillow 90.2/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:24.311Neviscerate
[finish]
Fluffy_Pillow 69.3/100 69% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:25.316Hsymbols_of_death
[cds]
Combo 4 80.5/100 80% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:25.316Oshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:25.316Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:26.318Ksecret_technique
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:27.323Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:28.328Mcoup_de_grace
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:29.532Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:30.536Neviscerate
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:31.540Dshadowstrike
[build]
Fluffy_Pillow 92.1/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:32.545Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:33.549Ebackstab
[build]
Fluffy_Pillow 84.5/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:34.555Neviscerate
[finish]
Fluffy_Pillow 55.3/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:35.559Ebackstab
[build]
Fluffy_Pillow 74.1/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:36.564Ebackstab
[build]
Fluffy_Pillow 44.9/100 45% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:38.664Ebackstab
[build]
Fluffy_Pillow 43.5/100 44% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
3:40.953Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
3:41.957Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
3:44.412Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
3:47.627Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:48.629Ebackstab
[build]
Fluffy_Pillow 50.7/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:50.119Hsymbols_of_death
[cds]
Combo 4 30.5/100 31% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:50.119Oshadow_dance
[stealth_cds]
Combo 4 70.5/100 71% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:50.119Ksecret_technique
[finish]
Fluffy_Pillow 70.5/100 71% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:51.124Dshadowstrike
[build]
Fluffy_Pillow 89.2/100 89% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:52.129Mcoup_de_grace
[finish]
Fluffy_Pillow 62.9/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:53.334Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(8), shadow_techniques(7), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:54.338Neviscerate
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:55.341Dshadowstrike
[build]
Fluffy_Pillow 92.9/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade, flawless_form(9), shadow_techniques(7), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:56.344Neviscerate
[finish]
Fluffy_Pillow 66.9/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:57.349Dshadowstrike
[build]
Fluffy_Pillow 78.0/100 78% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:58.355Lrupture
[finish]
Fluffy_Pillow 52.1/100 52% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
3:59.360Ebackstab
[build]
Fluffy_Pillow 73.3/100 73% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:00.365Ebackstab
[build]
Fluffy_Pillow 52.4/100 52% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:01.507Neviscerate
[finish]
Fluffy_Pillow 41.0/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:02.512Ebackstab
[build]
Fluffy_Pillow 52.1/100 52% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:05.049Ebackstab
[build]
Fluffy_Pillow 44.2/100 44% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:07.184Ksecret_technique
[finish]
Fluffy_Pillow 30.9/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
4:08.188Pvanish
[stealth_cds]
Combo 4 50.5/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
4:08.188Dshadowstrike
[build]
Fluffy_Pillow 50.5/100 50% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
4:10.732Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(3), bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
4:11.737Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
4:14.227Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
4:17.116Mcoup_de_grace
[finish]
Fluffy_Pillow 35.4/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:18.321Ebackstab
[build]
Fluffy_Pillow 77.1/100 77% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:19.326Ebackstab
[build]
Fluffy_Pillow 51.7/100 52% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:22.131Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
4:24.131Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:25.136Ebackstab
[build]
Fluffy_Pillow 54.9/100 55% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:27.253Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:30.596Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:31.603Jflagellation
[cds]
Fluffy_Pillow 16.0/100 16% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:32.608Hsymbols_of_death
[cds]
Combo 4 26.5/100 27% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(2), flawless_form, shadow_techniques, flagellation_buff, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:32.608Oshadow_dance
[stealth_cds]
Combo 4 66.5/100 67% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:32.608Neviscerate
[finish]
Fluffy_Pillow 66.5/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:33.612Dshadowstrike
[build]
Fluffy_Pillow 99.9/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, escalating_blade(2), flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(11), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:34.616Ksecret_technique
[finish]
Fluffy_Pillow 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, escalating_blade(2), flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(11), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:35.620Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(21), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:36.625Ishadow_blades
[cds]
Combo 4 65.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_buff(21), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:36.625Neviscerate
[finish]
Fluffy_Pillow 65.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_buff(21), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:37.628Dshadowstrike
[build]
Fluffy_Pillow 84.1/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_buff(28), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:38.632Mcoup_de_grace
[finish]
Fluffy_Pillow 49.7/100 50% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(4), flawless_form(4), shadow_techniques(5), flagellation_buff(28), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:39.837Dshadowstrike
[build]
Fluffy_Pillow 95.6/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(8), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:40.844Neviscerate
[finish]
Fluffy_Pillow 69.3/100 69% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(8), shadow_techniques(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:41.849Neviscerate
[finish]
Fluffy_Pillow 80.0/100 80% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(8), shadow_techniques(2), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:42.854Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(8), shadow_techniques(6), flagellation_buff(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:43.858Hsymbols_of_death
[cds]
Combo 4 70.5/100 70% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:43.858Oshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:43.858Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:44.862Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), premeditation, shadow_techniques(8), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:45.865Fcold_blood
[cds]
Combo 4 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:45.865Ksecret_technique
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(8), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:46.870Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:47.876Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:48.880Neviscerate
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:49.885Neviscerate
[finish]
Fluffy_Pillow 84.1/100 84% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:50.888Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:51.891Neviscerate
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:52.895Ebackstab
[build]
Fluffy_Pillow 92.1/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:53.901Lrupture
[finish]
Fluffy_Pillow 62.7/100 63% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:54.904Ebackstab
[build]
Fluffy_Pillow 91.5/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:55.908Ebackstab
[build]
Fluffy_Pillow 70.3/100 70% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:56.912Mcoup_de_grace
[finish]
Fluffy_Pillow 49.1/100 49% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:58.116Ebackstab
[build]
Fluffy_Pillow 82.1/100 82% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:59.121Ebackstab
[build]
Fluffy_Pillow 56.9/100 57% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:00.907Ebackstab
[build]
Fluffy_Pillow 40.1/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:03.908Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:04.912Hsymbols_of_death
[cds]
Combo 4 51.2/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:05.022Oshadow_dance
[stealth_cds]
Combo 4 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:05.022Dshadowstrike
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:06.029Ksecret_technique
[finish]
Fluffy_Pillow 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:07.034Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
5:08.039Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
5:09.043Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
5:10.047Mcoup_de_grace
[finish]
Fluffy_Pillow 65.1/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
5:11.252Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
5:12.256Dshadowstrike
[build]
Fluffy_Pillow 73.6/100 74% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
5:13.260Gpotion
[cds]
Fluffy_Pillow 39.1/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
5:13.260Neviscerate
[finish]
Fluffy_Pillow 39.1/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:14.264Ebackstab
[build]
Fluffy_Pillow 58.1/100 58% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:16.099Ebackstab
[build]
Fluffy_Pillow 46.2/100 46% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:18.100Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:19.105Ebackstab
[build]
Fluffy_Pillow 47.1/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:21.745Ebackstab
[build]
Fluffy_Pillow 40.0/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:24.249Ksecret_technique
[finish]
Fluffy_Pillow 35.5/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:25.253Ebackstab
[build]
Fluffy_Pillow 50.5/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:27.697Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:29.621Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:30.626Hsymbols_of_death
[cds]
Combo 4 46.3/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:30.626Ebackstab
[build]
Fluffy_Pillow 86.3/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(2), the_rotten(2), poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:31.629Neviscerate
[finish]
Fluffy_Pillow 57.3/100 57% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), the_rotten, poised_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:32.636Oshadow_dance
[stealth_cds]
Combo 4 63.3/100 63% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:32.636Dshadowstrike
[build]
Fluffy_Pillow 63.3/100 63% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), premeditation, the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:33.639Neviscerate
[finish]
Fluffy_Pillow 37.5/100 38% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit, tempered_potion
5:34.643Dshadowstrike
[build]
Fluffy_Pillow 71.7/100 72% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit, tempered_potion
5:35.647Neviscerate
[finish]
Fluffy_Pillow 46.0/100 46% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit, tempered_potion
5:36.651Dshadowstrike
[build]
Fluffy_Pillow 57.2/100 57% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit, tempered_potion
5:38.521Dshadowstrike
[build]
Fluffy_Pillow 49.7/100 50% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(4), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:40.438Neviscerate
[finish]
Fluffy_Pillow 43.3/100 43% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(8), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:41.442Neviscerate
[finish]
Fluffy_Pillow 63.1/100 63% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(3), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:42.445Ebackstab
[build]
Fluffy_Pillow 75.0/100 75% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(3), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470615436030639788 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste0.69%0.69%456
Versatility24.83%22.21%17321
Attack Power6560561244938
Mastery78.39%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 640.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Trinket2 Void Reaper's Contract
ilevel: 639, stats: { +3,607 Agi }
item effects: { equip: Void Reaper's Contract }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 4"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
trinket2=void_reapers_contract,id=212456,bonus_id=6652/10356/10299/1540/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.81
# gear_agility=39788
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=447
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Equipped : 1,476,178 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,476,177.71,476,177.72,851.4 / 0.193%202,750.4 / 13.7%49,374.1
Resource Out In Waiting APM Active
Energy29.929.711.67%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Equipped1,476,178
Auto Attack 0 (70,249)0.0% (4.8%)3.9122.25s5,364,1210

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,9043.2%355.10.98s39,63140,528Direct355.138,37677,39839,63319.3%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage355.14355.140.000.000.000.97790.000014,074,388.3918,362,440.6023.35%40,528.4340,528.43
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.35%228.5416529738,376.0422,77364,93038,385.9636,44240,4228,770,02711,442,40523.35%
crit19.30%68.533810677,397.9047,439130,05577,455.4969,50085,4915,304,3616,920,03623.35%
miss16.35%58.0632900.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,3461.6%354.60.98s19,76020,140Direct354.619,12038,56719,76219.3%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.60354.600.000.000.000.98110.00007,006,810.759,141,695.4723.35%20,140.3620,140.36
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.36%228.2315930019,119.7111,36432,33319,126.2318,28420,0954,363,4885,693,41823.36%
crit19.33%68.544010338,566.8922,69464,76238,587.3834,98742,5102,643,3233,448,27723.34%
miss16.31%57.8331870.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,2532.1%75.53.67s120,526119,987Direct75.572,891188,936120,53541.1%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.4975.490.000.000.001.00450.00009,098,732.8111,904,412.9123.57%119,986.98119,986.98
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.95%44.50236772,891.0157,139145,13672,889.7168,82078,1513,243,8604,245,78823.59%
crit41.05%30.991650188,936.44125,912422,135189,046.49173,612215,0775,854,8737,658,62523.57%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.49

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 89,799 (128,320)6.1% (8.7%)13.322.28s2,894,3462,403,016Direct39.8 (78.2)522,5081,048,567676,60729.3% (29.4%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3039.830.000.000.001.20450.000026,939,010.8135,071,747.3623.19%2,403,015.612,403,015.61
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.70%28.161344522,507.56114,7551,909,117522,174.67344,031753,34214,707,27319,147,42523.19%
crit29.30%11.672251,048,567.41239,8463,713,7051,049,057.41484,4491,814,87912,231,73815,924,32223.20%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.30
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,5212.6%0.00.00s00Direct38.4231,227467,619301,07129.6%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.380.000.000.000.00000.000011,552,493.1911,552,493.190.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.44%27.041543231,227.4357,087828,243231,296.51156,226308,6016,248,5426,248,5420.00%
crit29.56%11.35224467,618.56109,2301,641,099468,112.11188,635849,7145,303,9525,303,9520.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,029)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,0291.4%22.312.94s269,6720Direct22.3269,7560269,7560.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.3322.320.000.000.000.00000.00006,020,765.656,020,765.650.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.321237269,755.66260,578318,025269,710.59262,700279,7786,020,7666,020,7660.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 256,626 (366,987)17.4% (24.9%)68.74.38s1,600,9621,593,811Direct68.7 (136.2)856,7631,755,9331,119,73029.2% (29.2%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.7568.750.000.000.001.00450.000076,958,346.43100,110,524.1623.13%1,593,810.991,593,810.99
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.76%48.653168856,763.47210,8622,463,332856,461.81698,0331,013,92041,666,83554,204,36823.13%
crit29.24%20.109351,755,932.65422,3574,760,6791,757,042.921,107,8532,474,49435,291,51145,906,15723.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.75

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,3617.5%67.44.46s490,7950Direct67.4376,874768,481490,93229.1%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.4567.450.000.000.000.00000.000033,103,865.1833,103,865.180.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.88%47.813266376,874.02100,5271,068,681377,112.02296,089453,83518,014,67318,014,6730.00%
crit29.12%19.64834768,481.36201,3562,102,564768,256.16493,9601,101,54415,089,19215,089,1920.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,035 (21,060)0.1% (1.4%)3.791.36s1,702,2971,695,026Direct3.7 (27.6)69,676139,34783,50619.8% (19.8%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000310,057.04310,057.040.00%1,695,026.171,695,026.17
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.20%2.980469,676.2960,925134,51369,200.590131,984207,567207,5670.00%
crit19.80%0.7404139,346.66122,033263,59277,873.340263,592102,490102,4900.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 20,0261.4%0.00.00s00Direct23.9209,728421,069251,55419.8%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.900.000.000.000.00000.00006,012,390.606,012,390.600.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.21%19.17928209,728.3679,617457,741209,538.25176,739248,2594,020,7324,020,7320.00%
crit19.79%4.73012421,068.73159,472867,106416,879.180797,3661,991,6591,991,6590.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,2130.8%0.00.00s00Direct283.810,79421,70112,91319.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00283.850.000.000.000.00000.00003,664,845.793,664,845.790.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.58%228.7115631410,793.717,51417,72310,797.0510,23911,4472,468,5402,468,5400.00%
crit19.42%55.13268921,701.3615,05135,50021,711.0219,37624,3581,196,3061,196,3060.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,734 (116,944)6.7% (7.9%)9.531.31s3,674,8203,658,746Periodic167.6 (335.2)135,747281,047176,79928.2% (28.4%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.550.00167.62167.627.081.00451.740229,626,977.7129,626,977.710.00%116,467.363,658,746.19
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.76%120.2886163135,746.58134425,420135,836.35119,677153,00116,325,76716,325,7670.00%
crit28.24%47.342577281,047.36308830,539281,393.01211,749378,90713,301,21113,301,2110.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.55
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,2101.2%167.61.76s32,5970Periodic167.624,92251,90832,60028.5%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.620.000.00167.620.000.00000.00005,464,057.005,464,057.000.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.54%119.917915624,922.489,67178,00524,935.2321,55528,1302,988,0082,988,0080.00%
crit28.46%47.71258251,908.0119,371151,48451,952.7637,50570,4772,476,0492,476,0490.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (272,019)0.0% (18.4%)16.118.97s5,080,0715,057,513

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.060.000.000.000.001.00450.00000.000.000.00%5,057,512.625,057,512.62

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.06
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,9754.7%0.00.00s00Direct16.1683,8822,111,0991,307,02543.7%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.060.000.000.000.00000.000020,986,638.4227,355,635.3923.28%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.34%9.05315683,881.67150,6161,611,458684,332.77444,060997,6676,187,5998,086,96823.50%
crit43.66%7.013132,111,098.91313,5634,093,7902,147,676.541,371,5093,243,32114,799,03919,268,66723.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 202,04513.7%0.00.00s00Direct32.0993,1143,037,2741,893,27744.0%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0032.030.000.000.000.00000.000060,611,270.1960,611,270.190.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.99%17.93927993,114.02221,6202,372,597995,478.87720,1061,283,04917,810,67617,810,6760.00%
crit44.01%14.106243,037,273.96466,1015,920,1073,065,138.962,077,4954,287,13142,800,59442,800,5940.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (105,032)0.0% (7.1%)3.790.91s8,636,4260

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 105,0327.1%386.01.20s81,6900Periodic386.081,689081,6890.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage385.990.000.00385.990.000.00000.000031,531,162.6331,531,162.630.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%385.9929047281,689.38401,079,72281,716.1169,24995,83831,531,16331,531,1630.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1830.43
  • base_dd_max:1830.43
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,5348.0%52.45.80s672,019669,012Direct52.4280,760916,737672,03361.5%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.4152.410.000.000.001.00450.000035,221,475.7845,925,802.5823.31%669,012.02669,012.02
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.47%20.161031280,759.89130,261417,492280,763.80248,637319,8885,659,7907,373,82923.25%
crit61.53%32.252144916,736.62287,0431,426,954917,513.53842,361994,15629,561,68638,551,97323.32%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.40

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,7570.3%2.371.36s480,0630Direct2.3401,836804,088480,11319.5%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.342.340.000.000.000.00000.00001,124,042.001,124,042.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.55%1.8907401,836.00377,346487,508335,763.620473,100757,789757,7890.00%
crit19.45%0.4604804,087.52755,824950,400299,982.930950,400366,253366,2530.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8420.1%2.376.55s109,7690Direct2.391,562183,642109,79119.8%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.302.300.000.000.000.00000.0000252,593.95252,593.950.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.20%1.850891,562.1483,958118,71976,491.680116,766168,957168,9570.00%
crit19.80%0.4604183,641.78168,168240,74665,060.500227,66783,63683,6360.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:65498.00
  • base_dd_max:65498.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,3933.2%19.115.16s744,3580Periodic107.8132,1330132,1330.0%0.0%71.8%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.130.00107.81107.8112.180.00002.000014,242,998.9214,242,998.920.00%66,053.570.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.8162156132,133.0760,995220,946131,043.5272,204177,11014,242,99914,242,9990.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 73,5635.0%37.47.84s590,8610Direct37.4496,871994,599590,91818.9%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage37.4037.400.000.000.000.00000.000022,098,191.4122,098,191.410.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.11%30.331150496,871.09453,001866,359496,672.85469,918552,27215,071,59415,071,5940.00%
crit18.89%7.07018994,599.47907,3601,704,410993,781.0501,279,1897,026,5977,026,5970.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,4380.3%2.370.44s572,9140Direct2.3481,567964,450572,94818.9%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.332.330.000.000.000.00000.00001,333,167.851,333,167.850.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.08%1.8909481,566.54452,539592,224400,298.280592,224908,536908,5360.00%
crit18.92%0.4403964,449.93906,4361,135,437342,272.5801,099,150424,632424,6320.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,5455.8%58.35.15s440,6860Direct58.3367,783740,129440,66619.6%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.2558.250.000.000.000.00000.000025,671,727.2933,535,493.7223.45%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.42%46.853069367,783.48220,828572,381367,965.67339,523397,96617,228,08222,507,45923.46%
crit19.58%11.41226740,129.42442,3191,146,479740,569.32542,005890,2538,443,64511,028,03523.43%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Equipped
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.71s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.792.18s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.311.94s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.267.38s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.220.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.367.93s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.340.0068.940.000.330.00000.83490.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5307.56s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 99.03.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.960.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.373.51s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.17s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.330.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.33
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.376.55s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.302.300.000.000.000.00000.00000.001,579,118.180.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.30090.00000.000001,579,11890.19%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8420.1%2.376.55s109,7690Direct2.391,562183,642109,79119.8%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.302.300.000.000.000.00000.0000252,593.95252,593.950.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.20%1.850891,562.1483,958118,71976,491.680116,766168,957168,9570.00%
crit19.80%0.4604183,641.78168,168240,74665,060.500227,66783,63683,6360.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:65498.00
  • base_dd_max:65498.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.40s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.30
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.25s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.382.22s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1592.8159.7s0.5s278.0s99.94%100.00%583.1 (583.1)0.1

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:34.5s / 328.2s
  • trigger_min/max:0.0s / 4.7s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 359.9s
  • uptime_min/max:99.04% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.24%
  • acrobatic_strikes_3:0.20%
  • acrobatic_strikes_4:0.17%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.34%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.6119.1s3.5s128.9s97.41%0.00%74.3 (77.1)1.3

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 351.3s
  • trigger_min/max:1.0s / 40.6s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 357.8s
  • uptime_min/max:89.40% / 99.44%

Stack Uptimes

  • alacrity_1:2.98%
  • alacrity_2:2.19%
  • alacrity_3:1.79%
  • alacrity_4:1.64%
  • alacrity_5:88.81%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.50%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.64%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.10.019.0s19.0s6.9s37.01%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 58.5s
  • trigger_min/max:9.2s / 58.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.69% / 41.35%

Stack Uptimes

  • bolstering_shadows_1:37.01%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.6s90.6s0.1s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:85.0s / 99.5s
  • trigger_min/max:85.0s / 99.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.09%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0126.6s111.6s4.3s1.82%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.4s
  • trigger_min/max:90.0s / 193.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.5s
  • uptime_min/max:0.00% / 8.50%

Stack Uptimes

  • cryptic_instructions_1:1.82%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.348.123.2s23.2s8.2s36.45%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 70.5s
  • trigger_min/max:8.0s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.22% / 39.64%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.55%
  • danse_macabre_3:6.65%
  • danse_macabre_4:16.31%
  • danse_macabre_5:8.88%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.440.7s3.7s35.4s89.98%95.60%74.4 (74.4)6.7

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 177.5s
  • trigger_min/max:1.0s / 39.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 154.9s
  • uptime_min/max:81.96% / 97.74%

Stack Uptimes

  • deeper_daggers_1:89.98%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.10.019.0s19.0s3.4s18.37%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 58.5s
  • trigger_min/max:9.2s / 58.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.01% / 21.72%

Stack Uptimes

  • disorienting_strikes_1:12.18%
  • disorienting_strikes_2:6.19%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.30.0130.2s111.4s4.0s1.67%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 287.2s
  • trigger_min/max:90.0s / 251.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s
  • uptime_min/max:0.00% / 6.08%

Stack Uptimes

  • errant_manaforge_emission_1:1.67%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.122.1s5.2s17.4s81.59%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 62.6s
  • trigger_min/max:1.0s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.5s
  • uptime_min/max:64.72% / 92.97%

Stack Uptimes

  • escalating_blade_1:25.00%
  • escalating_blade_2:22.28%
  • escalating_blade_3:22.42%
  • escalating_blade_4:11.89%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.6s90.6s14.7s18.18%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:81.7s / 184.6s
  • trigger_min/max:81.7s / 184.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:12.54% / 20.82%

Stack Uptimes

  • ethereal_powerlink_1:18.18%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.284.2s72.1s15.4s10.72%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4576.07

Trigger Details

  • interval_min/max:15.0s / 310.7s
  • trigger_min/max:0.3s / 310.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.7s
  • uptime_min/max:0.00% / 41.30%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.72%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.65%0.00%14.3 (96.7)3.6

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.1s
  • trigger_min/max:1.0s / 87.9s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s
  • uptime_min/max:12.87% / 16.95%

Stack Uptimes

  • flagellation_buff_1:1.32%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.62%
  • flagellation_buff_10:0.53%
  • flagellation_buff_11:0.47%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.03%
  • flagellation_buff_18:0.06%
  • flagellation_buff_19:0.43%
  • flagellation_buff_20:0.38%
  • flagellation_buff_21:0.31%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.01%
  • flagellation_buff_24:0.19%
  • flagellation_buff_25:0.83%
  • flagellation_buff_26:0.38%
  • flagellation_buff_27:0.19%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.11%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.22%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.3s / 98.1s
  • trigger_min/max:78.3s / 98.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.37% / 16.23%

Stack Uptimes

  • flagellation_persist_30:14.22%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.20.6109.3s75.1s35.5s25.42%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.4s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 79.20%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.42%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.0s76.0s35.3s25.01%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:31.0s / 316.8s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 177.1s
  • uptime_min/max:0.00% / 71.16%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.01%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.9s77.6s35.2s25.13%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 348.9s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 180.0s
  • uptime_min/max:0.00% / 74.19%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.13%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6110.3s77.1s34.9s24.44%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.6s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 208.1s
  • uptime_min/max:0.00% / 80.75%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.44%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.60.039.9s3.4s59.4s95.33%100.00%0.0 (0.0)3.9

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.62%
  • flawless_form_2:8.81%
  • flawless_form_3:11.77%
  • flawless_form_4:9.64%
  • flawless_form_5:2.75%
  • flawless_form_6:4.40%
  • flawless_form_7:5.89%
  • flawless_form_8:11.28%
  • flawless_form_9:18.56%
  • flawless_form_10:8.81%
  • flawless_form_11:1.46%
  • flawless_form_12:0.08%
  • flawless_form_13:0.00%
  • flawless_form_14:0.01%
  • flawless_form_15:0.16%
  • flawless_form_16:0.09%
  • flawless_form_17:0.02%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)2.00.286.8s72.2s16.9s11.00%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.6s / 304.2s
  • trigger_min/max:0.3s / 304.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.1s
  • uptime_min/max:0.00% / 41.34%

Stack Uptimes

  • nascent_empowerment_Crit_1:11.00%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)2.00.285.0s71.7s16.9s11.14%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.1s / 321.0s
  • trigger_min/max:0.2s / 321.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.0s
  • uptime_min/max:0.00% / 42.60%

Stack Uptimes

  • nascent_empowerment_Haste_1:11.14%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.287.9s74.8s17.0s10.68%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.4s / 317.6s
  • trigger_min/max:0.2s / 317.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.7s
  • uptime_min/max:0.00% / 44.94%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.68%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.287.8s73.4s17.0s10.81%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.4s / 312.3s
  • trigger_min/max:0.1s / 312.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 52.6s
  • uptime_min/max:0.00% / 49.13%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.81%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.90.422.1s21.3s3.7s17.20%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.9s
  • trigger_min/max:1.0s / 62.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:8.96% / 28.52%

Stack Uptimes

  • poised_shadows_1:17.20%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.30.017.9s18.9s1.1s2.61%11.22%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 68.3s
  • trigger_min/max:1.0s / 68.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.74% / 4.61%

Stack Uptimes

  • premeditation_1:2.61%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0128.3s106.6s3.9s1.61%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.6s
  • trigger_min/max:90.0s / 201.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.2s
  • uptime_min/max:0.00% / 7.18%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.61%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.281.4s70.3s15.3s10.56%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:24846.31

Trigger Details

  • interval_min/max:15.0s / 304.0s
  • trigger_min/max:1.0s / 304.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 39.3s
  • uptime_min/max:0.00% / 43.03%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.56%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.70.090.8s90.8s15.8s19.20%17.16%0.0 (0.0)3.5

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 99.1s
  • trigger_min/max:90.0s / 99.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 16.0s
  • uptime_min/max:16.80% / 21.86%

Stack Uptimes

  • shadow_blades_1:19.20%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.2s23.2s8.2s36.45%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 70.5s
  • trigger_min/max:8.0s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.22% / 39.64%

Stack Uptimes

  • shadow_dance_1:36.45%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.3138.74.4s1.4s3.5s79.12%95.53%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 46.5s
  • trigger_min/max:0.5s / 6.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.8s
  • uptime_min/max:72.15% / 87.41%

Stack Uptimes

  • shadow_techniques_1:20.52%
  • shadow_techniques_2:20.88%
  • shadow_techniques_3:9.39%
  • shadow_techniques_4:10.52%
  • shadow_techniques_5:6.06%
  • shadow_techniques_6:5.83%
  • shadow_techniques_7:2.57%
  • shadow_techniques_8:2.34%
  • shadow_techniques_9:0.49%
  • shadow_techniques_10:0.46%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.01%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s298.3s99.32%87.66%99.0 (99.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.3s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.40.0106.1s107.7s9.8s1.20%0.00%0.0 (0.0)0.3

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:4.0s / 338.7s
  • trigger_min/max:3.5s / 338.7s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 17.0s
  • uptime_min/max:0.00% / 12.91%

Stack Uptimes

  • storm_sewers_citrine_1:1.20%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0112.3s105.9s9.8s1.16%0.00%0.0 (0.0)0.3

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:1.0s / 322.9s
  • trigger_min/max:1.0s / 322.9s
  • trigger_pct:100.00%
  • duration_min/max:1.9s / 19.3s
  • uptime_min/max:0.00% / 11.51%

Stack Uptimes

  • storm_sewers_citrine_1:1.16%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0104.2s88.2s9.9s1.26%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.2s / 312.3s
  • trigger_min/max:2.2s / 268.6s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 18.0s
  • uptime_min/max:0.00% / 10.57%

Stack Uptimes

  • storm_sewers_citrine_1:1.26%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0113.8s103.0s9.9s1.33%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:15.9s / 322.9s
  • trigger_min/max:1.0s / 305.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.0s
  • uptime_min/max:0.00% / 14.97%

Stack Uptimes

  • storm_sewers_citrine_1:1.33%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0114.6s103.2s10.0s1.23%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.6s / 320.5s
  • trigger_min/max:4.0s / 320.5s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 18.2s
  • uptime_min/max:0.00% / 15.42%

Stack Uptimes

  • storm_sewers_citrine_1:1.23%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.284.0s70.3s15.5s10.69%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1374.86
  • stat:haste_rating
  • amount:1374.86
  • stat:mastery_rating
  • amount:1374.86
  • stat:versatility_rating
  • amount:1374.86

Trigger Details

  • interval_min/max:15.0s / 316.0s
  • trigger_min/max:1.0s / 316.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.5s
  • uptime_min/max:0.00% / 35.08%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.69%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.4s21.4s2.3s10.99%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 62.6s
  • trigger_min/max:3.0s / 62.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.6s
  • uptime_min/max:9.07% / 14.55%

Stack Uptimes

  • supercharge_1_1:10.99%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.05%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 62.6s
  • trigger_min/max:1.0s / 62.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.7s
  • uptime_min/max:0.68% / 6.69%

Stack Uptimes

  • supercharge_2_1:2.05%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.2s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s
  • uptime_min/max:0.00% / 1.02%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 1.0s
  • uptime_min/max:0.00% / 0.34%

Stack Uptimes

  • supercharge_4_1:0.01%

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.5s21.3s24.6s61.11%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 96.1s
  • trigger_min/max:1.0s / 62.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:58.00% / 65.25%

Stack Uptimes

  • symbols_of_death_1:61.11%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.9s307.9s27.4s13.34%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.0s
  • trigger_min/max:300.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.95% / 18.12%

Stack Uptimes

  • tempered_potion_1:13.34%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.79%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.4s21.3s2.9s13.77%22.26%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:4.0s / 62.6s
  • trigger_min/max:1.0s / 62.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.2s
  • uptime_min/max:10.95% / 16.84%

Stack Uptimes

  • the_rotten_1:10.73%
  • the_rotten_2:3.04%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.4s
  • trigger_min/max:120.0s / 136.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.38%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.0142.7s33.6s15.1s0.46%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4757.50

Trigger Details

  • interval_min/max:15.3s / 279.7s
  • trigger_min/max:1.0s / 279.7s
  • trigger_pct:100.00%
  • duration_min/max:3.5s / 36.8s
  • uptime_min/max:0.00% / 12.23%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.50%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.00.287.8s75.7s15.3s10.31%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5516.42

Trigger Details

  • interval_min/max:15.1s / 339.4s
  • trigger_min/max:1.0s / 339.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 43.5s
  • uptime_min/max:0.00% / 34.31%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.31%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.525.076.06.0s0.7s62.3s
Skyfury (Off Hand)49.524.088.06.0s0.7s63.9s
Supercharger secret_technique12.48.016.023.7s9.2s90.6s
Cold Blood secret_technique3.63.04.090.6s85.0s99.5s
Supercharger rupture0.30.02.0187.7s23.4s299.5s
Supercharger coup_de_grace2.80.08.077.3s9.2s325.7s
Supercharger eviscerate13.06.022.023.1s1.0s141.2s
CP Spent During Flagellation202.8142.0250.011.2s1.0s88.9s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.38%6.00%13.90%0.7s0.0s2.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Equipped
Energy RegenEnergy1,443.663,041.7534.11%2.11398.6511.59%
Improved AmbushCombo Points52.4033.544.58%0.6418.8635.99%
PremeditationCombo Points17.2457.047.78%3.3163.6752.75%
Relentless StrikesEnergy107.664,281.0948.01%39.77125.072.84%
Shadow BladesCombo Points21.97114.0815.56%5.1917.7113.44%
Shadow TechniquesEnergy360.361,235.8213.86%3.43205.6114.26%
Shadow TechniquesCombo Points85.78240.9332.86%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.38107.6514.68%7.000.000.00%
BackstabCombo Points75.4975.1410.25%1.000.350.47%
ShadowstrikeCombo Points52.40104.7714.29%2.000.040.03%
Symbols of DeathEnergy14.30357.754.01%25.03214.0637.44%
Usage Type Count Total Tot% Avg RPE APR
Equipped
BackstabEnergy75.493,019.5633.66%40.0040.003,013.26
Coup de GraceEnergy13.30465.445.19%35.0035.0082,698.36
Coup de GraceCombo Points13.3090.8612.46%6.836.83423,653.65
EviscerateEnergy68.752,406.2426.83%35.0035.0045,740.27
EviscerateCombo Points68.75468.1664.19%6.816.81235,093.14
RuptureEnergy9.55238.722.66%25.0025.00146,999.62
RuptureCombo Points9.5565.268.95%6.836.83537,748.61
Secret TechniqueEnergy16.06481.855.37%30.0030.00169,341.63
Secret TechniqueCombo Points16.06105.0514.40%6.546.54776,732.72
ShadowstrikeEnergy52.402,358.1126.29%45.0044.9914,936.33
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6929.87943.146.60.5100.0
Combo Points0.02.442.43100.63.80.07.0

Statistics & Data Analysis

Fight Length
Equipped Fight Length
Count 1315
Mean 300.36
Minimum 240.36
Maximum 359.90
Spread ( max - min ) 119.55
Range [ ( max - min ) / 2 * 100% ] 19.90%
DPS
Equipped Damage Per Second
Count 1315
Mean 1476177.65
Minimum 1318350.48
Maximum 1619716.20
Spread ( max - min ) 301365.72
Range [ ( max - min ) / 2 * 100% ] 10.21%
Standard Deviation 52756.4937
5th Percentile 1390126.22
95th Percentile 1562066.91
( 95th Percentile - 5th Percentile ) 171940.69
Mean Distribution
Standard Deviation 1454.8327
95.00% Confidence Interval ( 1473326.23 - 1479029.07 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4907
0.1 Scale Factor Error with Delta=300 23759403
0.05 Scale Factor Error with Delta=300 95037611
0.01 Scale Factor Error with Delta=300 2375940255
Priority Target DPS
Equipped Priority Target Damage Per Second
Count 1315
Mean 1476177.65
Minimum 1318350.48
Maximum 1619716.20
Spread ( max - min ) 301365.72
Range [ ( max - min ) / 2 * 100% ] 10.21%
Standard Deviation 52756.4937
5th Percentile 1390126.22
95th Percentile 1562066.91
( 95th Percentile - 5th Percentile ) 171940.69
Mean Distribution
Standard Deviation 1454.8327
95.00% Confidence Interval ( 1473326.23 - 1479029.07 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4907
0.1 Scale Factor Error with Delta=300 23759403
0.05 Scale Factor Error with Delta=300 95037611
0.01 Scale Factor Error with Delta=300 2375940255
DPS(e)
Equipped Damage Per Second (Effective)
Count 1315
Mean 1476177.65
Minimum 1318350.48
Maximum 1619716.20
Spread ( max - min ) 301365.72
Range [ ( max - min ) / 2 * 100% ] 10.21%
Damage
Equipped Damage
Count 1315
Mean 442906009.79
Minimum 339626243.92
Maximum 542817509.36
Spread ( max - min ) 203191265.44
Range [ ( max - min ) / 2 * 100% ] 22.94%
DTPS
Equipped Damage Taken Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Equipped Healing Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Equipped Healing Per Second (Effective)
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Equipped Heal
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Equipped Healing Taken Per Second
Count 1315
Mean 3215.14
Minimum 0.00
Maximum 13592.82
Spread ( max - min ) 13592.82
Range [ ( max - min ) / 2 * 100% ] 211.39%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.40 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.49 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.30 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.06 secret_technique,if=variable.secret
L 9.55 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.30 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.75 eviscerate
actions.item
# count action,conditions
O 3.74 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.71 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.33 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNDMHNDFKNENNENENEEHQMDKNDNDNEELEENEHQNDKDNDDMENENEELHQDNKDNDNDEMENENEEENEENEEOLEEJHQPKDIMDNNDNENHQNDFKDNNDNELEMEENERENEHQKDNDNDDMENEEELEEKEEENEEMEEENEELEEOJHQKPDINDNDMNENHQNDFKDNDNNELEEHQMDNDKDNDMEENEENEEMHQDKDNDNDNELEEMRDKENEEENEENEEELEEOJHQKPDIMDNDNNENHQDFKNDNNDMNELEENENEHEQKDNDMNDGNEENEENEEEHQKDNDMDNDNEEN

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Equipped 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Equipped 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Equipped 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Equipped 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.003Gpotion
[cds]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence
0:01.003Jflagellation
[cds]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.008Neviscerate
[finish]
Fluffy_Pillow 90.2/100 90% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(5), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.014Rvanish
[stealth_cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.014Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(6), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.020Lrupture
[finish]
Fluffy_Pillow 73.1/100 73% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(9), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Hsymbols_of_death
[cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(4), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.028Ishadow_blades
[cds]
Equipped 69.2/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.028Ksecret_technique
[finish]
Fluffy_Pillow 69.2/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.031Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.036Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(8), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.040Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques, flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.046Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.050Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:12.056Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:13.062Mcoup_de_grace
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(9), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:14.265Hsymbols_of_death
[cds]
Equipped 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:14.265Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:15.270Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:16.274Fcold_blood
[cds]
Equipped 85.6/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:16.274Ksecret_technique
[finish]
Fluffy_Pillow 85.6/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:17.279Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:18.281Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:19.285Neviscerate
[finish]
Fluffy_Pillow 90.6/100 91% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:20.291Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, tempered_potion
0:21.295Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, tempered_potion
0:22.300Neviscerate
[finish]
Fluffy_Pillow 90.7/100 91% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.305Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, tempered_potion
0:24.308Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, tempered_potion
0:25.314Ebackstab
[build]
Fluffy_Pillow 97.3/100 97% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:26.319Ebackstab
[build]
Fluffy_Pillow 80.0/100 80% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.323Hsymbols_of_death
[cds]
Equipped 70.6/100 71% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.323Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(5), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.323Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
6.0/7 86% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(5), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.527Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.532Ksecret_technique
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:30.535Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(3), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:31.540Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:32.545Neviscerate
[finish]
Fluffy_Pillow 77.1/100 77% energy
6.0/7 86% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:33.550Dshadowstrike
[build]
Fluffy_Pillow 94.2/100 94% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:34.555Neviscerate
[finish]
Fluffy_Pillow 63.3/100 63% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:35.558Ebackstab
[build]
Fluffy_Pillow 85.4/100 85% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:36.561Ebackstab
[build]
Fluffy_Pillow 67.5/100 67% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:37.565Lrupture
[finish]
Fluffy_Pillow 49.5/100 50% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:38.569Ebackstab
[build]
Fluffy_Pillow 76.6/100 77% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:39.572Ebackstab
[build]
Fluffy_Pillow 58.7/100 59% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:40.576Neviscerate
[finish]
Fluffy_Pillow 38.9/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:41.580Ebackstab
[build]
Fluffy_Pillow 57.8/100 58% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(5), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:42.585Hsymbols_of_death
[cds]
Equipped 28.6/100 29% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:42.585Qshadow_dance
[stealth_cds]
Equipped 68.6/100 69% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:42.585Neviscerate
[finish]
Fluffy_Pillow 68.6/100 69% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), premeditation, the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:43.589Dshadowstrike
[build]
Fluffy_Pillow 97.4/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:44.593Ksecret_technique
[finish]
Fluffy_Pillow 71.3/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form, shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:45.597Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form, shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:46.601Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:47.606Dshadowstrike
[build]
Fluffy_Pillow 76.7/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:48.611Dshadowstrike
[build]
Fluffy_Pillow 50.5/100 51% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:49.917Mcoup_de_grace
[finish]
Fluffy_Pillow 35.6/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:51.122Ebackstab
[build]
Fluffy_Pillow 81.6/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:52.126Neviscerate
[finish]
Fluffy_Pillow 60.4/100 60% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
0:53.131Ebackstab
[build]
Fluffy_Pillow 79.2/100 79% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_crit
0:54.138Neviscerate
[finish]
Fluffy_Pillow 50.0/100 50% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_crit
0:55.142Ebackstab
[build]
Fluffy_Pillow 76.8/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
0:56.148Ebackstab
[build]
Fluffy_Pillow 47.6/100 48% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_crit
0:57.305Lrupture
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
0:58.310Hsymbols_of_death
[cds]
Equipped 59.9/100 60% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_crit
0:58.310Qshadow_dance
[stealth_cds]
Equipped 99.9/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:58.310Dshadowstrike
[build]
Fluffy_Pillow 99.9/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:59.314Neviscerate
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
1:00.317Ksecret_technique
[finish]
Fluffy_Pillow 99.4/100 99% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques, the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
1:01.321Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(3), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
1:02.326Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:03.331Dshadowstrike
[build]
Fluffy_Pillow 87.6/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:04.336Neviscerate
[finish]
Fluffy_Pillow 61.4/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:05.342Dshadowstrike
[build]
Fluffy_Pillow 72.8/100 73% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:06.347Ebackstab
[build]
Fluffy_Pillow 55.1/100 55% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:07.496Mcoup_de_grace
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:08.701Ebackstab
[build]
Fluffy_Pillow 82.7/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:09.707Neviscerate
[finish]
Fluffy_Pillow 62.0/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:10.711Ebackstab
[build]
Fluffy_Pillow 81.4/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:11.715Neviscerate
[finish]
Fluffy_Pillow 60.7/100 61% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:12.718Ebackstab
[build]
Fluffy_Pillow 67.0/100 67% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:13.722Ebackstab
[build]
Fluffy_Pillow 42.3/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:16.594Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:19.208Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:20.212Ebackstab
[build]
Fluffy_Pillow 51.6/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:22.494Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:24.876Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:25.883Ebackstab
[build]
Fluffy_Pillow 42.6/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:28.563Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:30.009Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 21.2/100 21% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:30.491Lrupture
[finish]
Fluffy_Pillow 26.6/100 27% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:31.497Ebackstab
[build]
Fluffy_Pillow 42.7/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_vers
1:34.729Ebackstab
[build]
Fluffy_Pillow 45.4/100 45% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), cryptic_instructions, flask_of_alchemical_chaos_vers
1:35.732Jflagellation
[cds]
Fluffy_Pillow 16.2/100 16% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, cryptic_instructions, flask_of_alchemical_chaos_vers
1:36.736Hsymbols_of_death
[cds]
Equipped 31.0/100 31% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, flagellation_buff, cryptic_instructions, flask_of_alchemical_chaos_vers
1:36.736Qshadow_dance
[stealth_cds]
Equipped 71.0/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_vers
1:36.736Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 71.0/100 71% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_vers
1:36.736Ksecret_technique
[finish]
Fluffy_Pillow 71.0/100 71% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:37.738Dshadowstrike
[build]
Fluffy_Pillow 99.8/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:38.742Ishadow_blades
[cds]
Equipped 73.5/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:38.742Mcoup_de_grace
[finish]
Fluffy_Pillow 73.5/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:39.947Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:40.951Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(9), flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:41.955Neviscerate
[finish]
Fluffy_Pillow 92.6/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:42.961Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:43.965Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:44.966Ebackstab
[build]
Fluffy_Pillow 84.5/100 85% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.970Neviscerate
[finish]
Fluffy_Pillow 63.3/100 63% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:46.975Hsymbols_of_death
[cds]
Equipped 82.1/100 82% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:46.975Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:46.975Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:47.980Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:48.983Fcold_blood
[cds]
Equipped 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:48.983Ksecret_technique
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:49.988Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:50.992Neviscerate
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(11), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:51.998Neviscerate
[finish]
Fluffy_Pillow 92.7/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:53.003Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:54.007Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:55.011Ebackstab
[build]
Fluffy_Pillow 84.7/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:56.015Lrupture
[finish]
Fluffy_Pillow 63.5/100 64% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
1:57.019Ebackstab
[build]
Fluffy_Pillow 92.3/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
1:58.025Mcoup_de_grace
[finish]
Fluffy_Pillow 63.2/100 63% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
1:59.229Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
2:00.233Ebackstab
[build]
Fluffy_Pillow 70.8/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_crit
2:01.234Neviscerate
[finish]
Fluffy_Pillow 41.6/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_crit
2:02.237Ebackstab
[build]
Fluffy_Pillow 55.5/100 55% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:03.829Rvanish
[stealth_cds]
Equipped 40.6/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:03.829Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
3.0/7 43% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), flawless_form(8), premeditation, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:06.751Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
2:07.755Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
2:09.798Hsymbols_of_death
[cds]
Equipped 37.1/100 37% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:10.025Qshadow_dance
[stealth_cds]
Equipped 79.5/100 80% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
2:10.025Ksecret_technique
[finish]
Fluffy_Pillow 79.5/100 80% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
2:11.029Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
2:12.034Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:13.038Dshadowstrike
[build]
Fluffy_Pillow 99.7/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:14.043Neviscerate
[finish]
Fluffy_Pillow 73.5/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:15.048Dshadowstrike
[build]
Fluffy_Pillow 79.4/100 79% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:16.052Dshadowstrike
[build]
Fluffy_Pillow 53.2/100 53% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:17.904Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:19.106Ebackstab
[build]
Fluffy_Pillow 82.2/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(6), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:20.111Neviscerate
[finish]
Fluffy_Pillow 61.6/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:21.115Ebackstab
[build]
Fluffy_Pillow 73.2/100 73% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:22.119Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:24.356Ebackstab
[build]
Fluffy_Pillow 43.8/100 44% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:25.909Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:26.913Ebackstab
[build]
Fluffy_Pillow 48.2/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:29.055Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:31.202Ksecret_technique
[finish]
Fluffy_Pillow 31.2/100 31% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:32.205Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(2), bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:34.711Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:37.562Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(3), shadow_techniques(2), bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:39.946Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(3), shadow_techniques(3), flask_of_alchemical_chaos_haste
2:40.951Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
2:43.747Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:46.493Mcoup_de_grace
[finish]
Fluffy_Pillow 38.9/100 39% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:47.697Ebackstab
[build]
Fluffy_Pillow 72.1/100 72% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:48.701Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:51.121Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:53.911Neviscerate
[finish]
Fluffy_Pillow 35.9/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(5), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:54.917Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(5), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:57.221Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(5), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:59.305Lrupture
[finish]
Fluffy_Pillow 27.4/100 27% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:00.309Ebackstab
[build]
Fluffy_Pillow 43.6/100 44% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:03.343Ebackstab
[build]
Fluffy_Pillow 45.4/100 45% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), shadow_techniques(2), nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:04.347Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 16.6/100 17% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:05.739Jflagellation
[cds]
Fluffy_Pillow 36.1/100 36% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form, shadow_techniques, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:06.745Hsymbols_of_death
[cds]
Equipped 51.3/100 51% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form, shadow_techniques(2), flagellation_buff, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:06.745Qshadow_dance
[stealth_cds]
Equipped 91.3/100 91% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:06.745Ksecret_technique
[finish]
Fluffy_Pillow 91.3/100 91% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:07.749Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(9), poised_shadows, bolstering_shadows, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:07.749Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(9), poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:08.755Ishadow_blades
[cds]
Equipped 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:08.755Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:09.760Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(6), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:10.766Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:11.770Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(8), flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:12.776Mcoup_de_grace
[finish]
Fluffy_Pillow 60.3/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(10), flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:13.978Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:14.982Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:15.986Neviscerate
[finish]
Fluffy_Pillow 71.4/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:16.991Hsymbols_of_death
[cds]
Equipped 90.8/100 91% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:16.991Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(2), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:16.991Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:17.994Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(10), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:19.001Fcold_blood
[cds]
Equipped 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:19.001Ksecret_technique
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:20.007Dshadowstrike
[build]
Fluffy_Pillow 97.9/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:21.010Neviscerate
[finish]
Fluffy_Pillow 72.0/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:22.015Dshadowstrike
[build]
Fluffy_Pillow 90.8/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:23.018Neviscerate
[finish]
Fluffy_Pillow 64.6/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:24.023Neviscerate
[finish]
Fluffy_Pillow 83.4/100 83% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:25.027Ebackstab
[build]
Fluffy_Pillow 94.2/100 94% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:26.033Lrupture
[finish]
Fluffy_Pillow 73.0/100 73% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:27.038Ebackstab
[build]
Fluffy_Pillow 88.8/100 89% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:28.043Ebackstab
[build]
Fluffy_Pillow 67.6/100 68% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:29.047Hsymbols_of_death
[cds]
Equipped 38.4/100 38% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:29.047Qshadow_dance
[stealth_cds]
Equipped 78.4/100 78% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:29.047Mcoup_de_grace
[finish]
Fluffy_Pillow 78.4/100 78% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), premeditation, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:30.251Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:31.256Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:32.259Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:33.264Ksecret_technique
[finish]
Fluffy_Pillow 73.4/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:34.268Dshadowstrike
[build]
Fluffy_Pillow 89.2/100 89% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:35.274Neviscerate
[finish]
Fluffy_Pillow 63.0/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:36.279Dshadowstrike
[build]
Fluffy_Pillow 81.8/100 82% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:37.285Mcoup_de_grace
[finish]
Fluffy_Pillow 55.6/100 56% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:38.488Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(15), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:39.493Ebackstab
[build]
Fluffy_Pillow 78.8/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(16), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:40.497Neviscerate
[finish]
Fluffy_Pillow 49.6/100 50% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(16), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:41.502Ebackstab
[build]
Fluffy_Pillow 68.4/100 68% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(11), shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:42.507Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(11), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
3:44.428Neviscerate
[finish]
Fluffy_Pillow 35.8/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:45.432Ebackstab
[build]
Fluffy_Pillow 54.6/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:47.096Ebackstab
[build]
Fluffy_Pillow 40.5/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:49.684Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
3:50.887Hsymbols_of_death
[cds]
Equipped 78.2/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:50.887Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:50.887Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:51.892Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:52.896Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(9), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
3:53.899Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:54.905Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:55.908Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:56.913Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:57.917Neviscerate
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:58.922Ebackstab
[build]
Fluffy_Pillow 77.2/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
3:59.923Lrupture
[finish]
Fluffy_Pillow 47.9/100 48% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_vers
4:00.925Ebackstab
[build]
Fluffy_Pillow 76.7/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:01.930Ebackstab
[build]
Fluffy_Pillow 55.5/100 55% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:03.101Mcoup_de_grace
[finish]
Fluffy_Pillow 44.1/100 44% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
4:04.305Rvanish
[stealth_cds]
Equipped 77.0/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
4:04.305Dshadowstrike
[build]
Fluffy_Pillow 77.0/100 77% energy
0.0/7 0% CP
slice_and_dice, vanish, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
4:05.309Ksecret_technique
[finish]
Fluffy_Pillow 50.8/100 51% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
4:06.312Ebackstab
[build]
Fluffy_Pillow 66.8/100 67% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
4:07.317Neviscerate
[finish]
Fluffy_Pillow 37.8/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
4:08.321Ebackstab
[build]
Fluffy_Pillow 52.8/100 53% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
4:10.538Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
4:13.502Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
4:16.242Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
4:17.247Ebackstab
[build]
Fluffy_Pillow 51.9/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
4:19.413Ebackstab
[build]
Fluffy_Pillow 44.9/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
4:21.775Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:22.778Ebackstab
[build]
Fluffy_Pillow 42.0/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:25.539Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:28.746Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:30.592Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:31.597Ebackstab
[build]
Fluffy_Pillow 51.6/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:33.486Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:34.491Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 12.2/100 12% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:35.763Jflagellation
[cds]
Fluffy_Pillow 26.2/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, cryptic_instructions, flask_of_alchemical_chaos_crit
4:36.767Hsymbols_of_death
[cds]
Equipped 41.0/100 41% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, flagellation_buff, cryptic_instructions, flask_of_alchemical_chaos_crit
4:36.767Qshadow_dance
[stealth_cds]
Equipped 81.0/100 81% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_crit
4:36.767Ksecret_technique
[finish]
Fluffy_Pillow 81.0/100 81% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_crit
4:37.770Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff(10), poised_shadows, bolstering_shadows, cryptic_instructions, flask_of_alchemical_chaos_crit
4:37.770Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff(10), poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:38.776Ishadow_blades
[cds]
Equipped 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:38.776Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:39.981Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(3), the_rotten, flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:40.985Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:41.991Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:42.996Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:44.002Neviscerate
[finish]
Fluffy_Pillow 77.2/100 77% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:45.006Ebackstab
[build]
Fluffy_Pillow 96.0/100 96% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:46.010Neviscerate
[finish]
Fluffy_Pillow 74.8/100 75% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:47.015Hsymbols_of_death
[cds]
Equipped 93.6/100 94% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:47.015Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(8), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:47.015Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(8), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:48.019Fcold_blood
[cds]
Equipped 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(12), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:48.019Ksecret_technique
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(12), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:49.022Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:50.027Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:51.032Neviscerate
[finish]
Fluffy_Pillow 82.1/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(11), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:52.036Neviscerate
[finish]
Fluffy_Pillow 93.5/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:53.039Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:54.044Mcoup_de_grace
[finish]
Fluffy_Pillow 82.7/100 83% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:55.247Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:56.252Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:57.257Lrupture
[finish]
Fluffy_Pillow 80.0/100 80% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:58.262Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:59.267Ebackstab
[build]
Fluffy_Pillow 80.0/100 80% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:00.271Neviscerate
[finish]
Fluffy_Pillow 59.9/100 60% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:01.276Ebackstab
[build]
Fluffy_Pillow 79.9/100 80% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:02.280Neviscerate
[finish]
Fluffy_Pillow 51.8/100 52% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:03.284Ebackstab
[build]
Fluffy_Pillow 62.7/100 63% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:04.826Hsymbols_of_death
[cds]
Equipped 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:05.025Ebackstab
[build]
Fluffy_Pillow 83.5/100 83% energy
2.0/7 29% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:06.030Qshadow_dance
[stealth_cds]
Equipped 63.4/100 63% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(7), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:06.030Ksecret_technique
[finish]
Fluffy_Pillow 63.4/100 63% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(7), premeditation, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:07.034Dshadowstrike
[build]
Fluffy_Pillow 75.4/100 75% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(3), premeditation, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:08.039Neviscerate
[finish]
Fluffy_Pillow 50.3/100 50% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:09.043Dshadowstrike
[build]
Fluffy_Pillow 93.3/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(8), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:10.049Mcoup_de_grace
[finish]
Fluffy_Pillow 76.2/100 76% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:11.252Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:12.257Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:13.262Gpotion
[cds]
Fluffy_Pillow 75.0/100 75% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
5:13.262Neviscerate
[finish]
Fluffy_Pillow 75.0/100 75% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, tempered_potion
5:14.267Ebackstab
[build]
Fluffy_Pillow 89.9/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:15.272Ebackstab
[build]
Fluffy_Pillow 61.7/100 62% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:16.276Neviscerate
[finish]
Fluffy_Pillow 41.6/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:17.279Ebackstab
[build]
Fluffy_Pillow 48.4/100 48% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:19.109Ebackstab
[build]
Fluffy_Pillow 41.9/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:21.739Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:22.743Ebackstab
[build]
Fluffy_Pillow 47.5/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:25.340Ebackstab
[build]
Fluffy_Pillow 40.7/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:28.261Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:29.848Hsymbols_of_death
[cds]
Equipped 22.4/100 22% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(2), flawless_form, shadow_techniques, flask_of_alchemical_chaos_vers, tempered_potion
5:30.025Qshadow_dance
[stealth_cds]
Equipped 64.3/100 64% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:30.025Ksecret_technique
[finish]
Fluffy_Pillow 64.3/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:31.030Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:32.037Neviscerate
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:33.042Dshadowstrike
[build]
Fluffy_Pillow 99.8/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:34.046Mcoup_de_grace
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:35.251Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:36.256Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:37.261Dshadowstrike
[build]
Fluffy_Pillow 88.2/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:38.266Neviscerate
[finish]
Fluffy_Pillow 54.4/100 54% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:39.272Ebackstab
[build]
Fluffy_Pillow 73.7/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:40.276Ebackstab
[build]
Fluffy_Pillow 52.9/100 53% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:41.859Neviscerate
[finish]
Fluffy_Pillow 38.7/100 39% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste2.79%2.79%1843
Versatility24.83%22.21%17321
Attack Power6162857457938
Mastery78.39%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Equipped"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Simulation & Raid Information

Iterations: 1327
Threads: 12
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.4 )

Performance:

Total Events Processed: 28968447
Max Event Queue: 705
Sim Seconds: 398576
CPU Seconds: 71.4375
Physical Seconds: 7.2816
Speed Up: 5579

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Combo 1 Combo 1 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 1 Combo 1 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.45sec 0 300.36sec
Combo 1 Combo 1 auto_attack_mh 0 14059140 46808 70.87 38399 77351 354.8 354.8 19.3% 16.4% 0.0% 0.0% 0.98sec 18342941 300.36sec
Combo 1 Combo 1 auto_attack_oh 1 6989034 23269 70.79 19121 38591 354.4 354.4 19.2% 16.4% 0.0% 0.0% 0.98sec 9118718 300.36sec
Combo 1 Combo 1 backstab 53 9119318 30361 15.11 72965 188865 75.6 75.6 41.1% 0.0% 0.0% 0.0% 3.69sec 11931805 300.36sec
Combo 1 Combo 1 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.81sec 0 300.36sec
Combo 1 Combo 1 coup_de_grace 441776 26810350 89261 7.93 521737 1043990 13.3 39.7 29.4% 0.0% 0.0% 0.0% 22.51sec 34907515 300.36sec
Combo 1 Combo 1 eviscerate_coup_de_grace_bonus 462244 11420437 38023 7.62 231287 466746 0.0 38.1 29.0% 0.0% 0.0% 0.0% 0.00sec 11420437 300.36sec
Combo 1 Combo 1 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.43sec 0 300.36sec
Combo 1 Combo 1 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 1 Combo 1 elemental_focusing_lens_onyx 461191 6037994 20103 4.47 269807 0 22.4 22.4 0.0% 0.0% 0.0% 0.0% 12.87sec 6037994 300.36sec
Combo 1 Combo 1 eviscerate 196819 76637155 255152 13.72 856140 1760485 68.7 68.7 28.8% 0.0% 0.0% 0.0% 4.37sec 99695214 300.36sec
Combo 1 Combo 1 eviscerate_bonus 328082 33020954 109938 13.45 377120 769044 67.3 67.3 28.9% 0.0% 0.0% 0.0% 4.46sec 33020954 300.36sec
Combo 1 Combo 1 flagellation 384631 312388 1040 0.74 69726 139450 3.7 3.7 20.5% 0.0% 0.0% 0.0% 91.44sec 312388 300.36sec
Combo 1 Combo 1 flagellation_damage 394757 5986420 19931 4.76 209811 420120 0.0 23.9 19.6% 0.0% 0.0% 0.0% 0.00sec 5986420 300.36sec
Combo 1 Combo 1 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 1 Combo 1 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 1 Combo 1 instant_poison 315585 3658383 12180 56.56 10803 21701 0.0 283.2 19.4% 0.0% 0.0% 0.0% 0.00sec 3658383 300.36sec
Combo 1 Combo 1 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.7 0.0 0.0% 0.0% 0.0% 0.0% 11.50sec 0 300.36sec
Combo 1 Combo 1 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 75.39sec 0 300.36sec
Combo 1 Combo 1 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 68.78sec 0 300.36sec
Combo 1 Combo 1 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.56sec 0 300.36sec
Combo 1 Combo 1 recuperator 426605 0 0 0.00 0 0 99.0 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.36sec
Combo 1 Combo 1 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 67.64sec 0 300.36sec
Combo 1 Combo 1 rupture ticks -1943 29623239 98744 33.52 135590 281106 9.6 167.6 28.3% 0.0% 0.0% 0.0% 31.35sec 29623239 300.36sec
Combo 1 Combo 1 rupture_replicating_shadows ticks -394031 5454048 18180 0.00 24930 51751 167.6 0.0 28.4% 0.0% 0.0% 0.0% 1.76sec 5454048 300.36sec
Combo 1 Combo 1 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.97sec 0 300.36sec
Combo 1 Combo 1 secret_technique_player 280720 20858074 69444 3.20 687417 2128187 0.0 16.0 42.6% 0.0% 0.0% 0.0% 0.00sec 27190761 300.36sec
Combo 1 Combo 1 secret_technique_clones 282449 60602401 201767 6.38 995129 3050207 0.0 32.0 43.9% 0.0% 0.0% 0.0% 0.00sec 60602401 300.36sec
Combo 1 Combo 1 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.95sec 0 300.36sec
Combo 1 Combo 1 shadow_blades_attack ticks -279043 31447005 104823 0.00 81562 0 385.5 0.0 0.0% 0.0% 0.0% 0.0% 1.21sec 31447005 300.36sec
Combo 1 Combo 1 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.17sec 0 300.36sec
Combo 1 Combo 1 shadowstrike 185438 35233921 117306 10.44 280785 916448 52.3 52.3 61.9% 0.0% 0.0% 0.0% 5.83sec 45943304 300.36sec
Combo 1 Combo 1 squall_sailors_citrine 462952 1135368 3780 0.48 401132 802147 2.4 2.4 18.2% 0.0% 0.0% 0.0% 68.53sec 1135368 300.36sec
Combo 1 Combo 1 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 1 Combo 1 storm_sewers_citrine 462958 0 0 0.47 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 71.54sec 1602481 300.36sec
Combo 1 Combo 1 storm_sewers_citrine_damage 468422 257187 856 0.47 91567 184095 2.3 2.3 20.1% 0.0% 0.0% 0.0% 71.54sec 257187 300.36sec
Combo 1 Combo 1 suffocating_darkness ticks -449217 14273139 47577 21.55 132448 0 19.3 107.7 0.0% 0.0% 0.0% 0.0% 15.53sec 14273139 300.36sec
Combo 1 Combo 1 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.39sec 0 300.36sec
Combo 1 Combo 1 thunderlords_crackling_citrine 462951 21967095 73136 7.39 497042 999520 37.0 37.0 19.3% 0.0% 0.0% 0.0% 7.96sec 21967095 300.36sec
Combo 1 Combo 1 undersea_overseers_citrine 462953 1334385 4443 0.46 481186 965656 2.3 2.3 19.4% 0.0% 0.0% 0.0% 75.60sec 1334385 300.36sec
Combo 1 Combo 1 unseen_blade 441144 25601195 85235 11.59 367518 741897 58.0 58.0 19.7% 0.0% 0.0% 0.0% 5.19sec 33444547 300.36sec
Combo 1 Combo 1 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.45sec 0 300.36sec
Combo 1 Combo 1 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 77.29sec 0 300.36sec
Combo 2 Combo 2 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 2 Combo 2 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.34sec 0 300.36sec
Combo 2 Combo 2 auto_attack_mh 0 13879082 46208 70.59 38268 77093 353.4 353.4 18.8% 16.4% 0.0% 0.0% 0.99sec 18109640 300.36sec
Combo 2 Combo 2 auto_attack_oh 1 6908247 23000 70.39 19067 38462 352.4 352.4 18.9% 16.4% 0.0% 0.0% 0.99sec 9013521 300.36sec
Combo 2 Combo 2 backstab 53 9021449 30036 15.05 72788 188358 75.3 75.3 40.6% 0.0% 0.0% 0.0% 3.70sec 11803754 300.36sec
Combo 2 Combo 2 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.96sec 0 300.36sec
Combo 2 Combo 2 coup_de_grace 441776 26339162 87692 7.93 512799 1039291 13.3 39.7 28.7% 0.0% 0.0% 0.0% 22.65sec 34294746 300.36sec
Combo 2 Combo 2 eviscerate_coup_de_grace_bonus 462244 11241809 37428 7.62 228296 460216 0.0 38.1 28.7% 0.0% 0.0% 0.0% 0.00sec 11241809 300.36sec
Combo 2 Combo 2 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.04sec 0 300.36sec
Combo 2 Combo 2 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 2 Combo 2 elemental_focusing_lens_onyx 461191 6025973 20063 4.48 268919 0 22.4 22.4 0.0% 0.0% 0.0% 0.0% 12.95sec 6025973 300.36sec
Combo 2 Combo 2 eviscerate 196819 75406352 251054 13.67 851353 1738594 68.4 68.4 28.3% 0.0% 0.0% 0.0% 4.38sec 98092180 300.36sec
Combo 2 Combo 2 eviscerate_bonus 328082 32505307 108222 13.41 374508 760775 67.1 67.1 28.5% 0.0% 0.0% 0.0% 4.46sec 32505307 300.36sec
Combo 2 Combo 2 flagellation 384631 306259 1020 0.74 69505 139287 3.7 3.7 18.6% 0.0% 0.0% 0.0% 91.35sec 306259 300.36sec
Combo 2 Combo 2 flagellation_damage 394757 5964040 19856 4.77 208837 418269 0.0 23.9 19.7% 0.0% 0.0% 0.0% 0.00sec 5964040 300.36sec
Combo 2 Combo 2 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 2 Combo 2 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 2 Combo 2 instant_poison 315585 3613647 12031 56.34 10754 21690 0.0 282.0 18.8% 0.0% 0.0% 0.0% 0.00sec 3613647 300.36sec
Combo 2 Combo 2 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.4 0.0 0.0% 0.0% 0.0% 0.0% 11.57sec 0 300.36sec
Combo 2 Combo 2 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 74.66sec 0 300.36sec
Combo 2 Combo 2 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 70.35sec 0 300.36sec
Combo 2 Combo 2 phantom_reaping 448669 6054981 20159 3.79 267836 537110 19.0 19.0 19.2% 0.0% 0.0% 0.0% 15.49sec 6054981 300.36sec
Combo 2 Combo 2 phantom_reaping_echo 448669 1013756 3375 2.58 66140 132469 12.9 12.9 18.6% 0.0% 0.0% 0.0% 6.75sec 1013756 300.36sec
Combo 2 Combo 2 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.58sec 0 300.36sec
Combo 2 Combo 2 recuperator 426605 0 0 0.00 0 0 99.0 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.36sec
Combo 2 Combo 2 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 71.28sec 0 300.36sec
Combo 2 Combo 2 rupture ticks -1943 29098937 96996 33.37 134289 278507 9.6 166.8 27.9% 0.0% 0.0% 0.0% 31.24sec 29098937 300.36sec
Combo 2 Combo 2 rupture_replicating_shadows ticks -394031 5345433 17818 0.00 24694 51319 166.8 0.0 27.6% 0.0% 0.0% 0.0% 1.77sec 5345433 300.36sec
Combo 2 Combo 2 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 19.00sec 0 300.36sec
Combo 2 Combo 2 secret_technique_player 280720 20700941 68921 3.20 675744 2104707 0.0 16.0 43.0% 0.0% 0.0% 0.0% 0.00sec 26990237 300.36sec
Combo 2 Combo 2 secret_technique_clones 282449 59899184 199425 6.39 986747 3006521 0.0 32.0 43.9% 0.0% 0.0% 0.0% 0.00sec 59899184 300.36sec
Combo 2 Combo 2 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.90sec 0 300.36sec
Combo 2 Combo 2 shadow_blades_attack ticks -279043 30992127 103307 0.00 80717 0 384.0 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 30992127 300.36sec
Combo 2 Combo 2 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.25sec 0 300.36sec
Combo 2 Combo 2 shadowstrike 185438 35057524 116719 10.45 279967 913176 52.3 52.3 61.6% 0.0% 0.0% 0.0% 5.86sec 45718419 300.36sec
Combo 2 Combo 2 squall_sailors_citrine 462952 1067206 3553 0.45 398069 802219 2.3 2.3 18.1% 0.0% 0.0% 0.0% 65.35sec 1067206 300.36sec
Combo 2 Combo 2 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 2 Combo 2 storm_sewers_citrine 462958 0 0 0.47 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 69.39sec 1590250 300.36sec
Combo 2 Combo 2 storm_sewers_citrine_damage 468422 250930 835 0.47 90493 181450 2.3 2.3 18.6% 0.0% 0.0% 0.0% 69.39sec 250930 300.36sec
Combo 2 Combo 2 suffocating_darkness ticks -449217 14103526 47012 21.44 131623 0 19.1 107.2 0.0% 0.0% 0.0% 0.0% 14.78sec 14103526 300.36sec
Combo 2 Combo 2 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.41sec 0 300.36sec
Combo 2 Combo 2 thunderlords_crackling_citrine 462951 21740298 72381 7.41 493235 989745 37.1 37.1 18.8% 0.0% 0.0% 0.0% 7.91sec 21740298 300.36sec
Combo 2 Combo 2 undersea_overseers_citrine 462953 1307219 4352 0.46 477385 956985 2.3 2.3 18.8% 0.0% 0.0% 0.0% 65.59sec 1307219 300.36sec
Combo 2 Combo 2 unseen_blade 441144 25328592 84328 11.60 366512 737264 58.1 58.1 18.8% 0.0% 0.0% 0.0% 5.21sec 33089988 300.36sec
Combo 2 Combo 2 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.34sec 0 300.36sec
Combo 2 Combo 2 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 77.55sec 0 300.36sec
Combo 3 Combo 3 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 3 Combo 3 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.34sec 0 300.36sec
Combo 3 Combo 3 auto_attack_mh 0 14073080 46854 70.88 38400 77334 354.8 354.8 19.4% 16.4% 0.0% 0.0% 0.98sec 18360913 300.36sec
Combo 3 Combo 3 auto_attack_oh 1 7009658 23338 70.81 19125 38611 354.5 354.5 19.4% 16.4% 0.0% 0.0% 0.98sec 9145210 300.36sec
Combo 3 Combo 3 backstab 53 9121378 30368 15.12 72949 189038 75.7 75.7 41.0% 0.0% 0.0% 0.0% 3.68sec 11932766 300.36sec
Combo 3 Combo 3 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.68sec 0 300.36sec
Combo 3 Combo 3 coup_de_grace 441776 26643437 88705 7.96 517379 1037378 13.3 39.8 29.1% 0.0% 0.0% 0.0% 22.46sec 34687842 300.36sec
Combo 3 Combo 3 eviscerate_coup_de_grace_bonus 462244 11375262 37872 7.66 229991 459628 0.0 38.3 29.1% 0.0% 0.0% 0.0% 0.00sec 11375262 300.36sec
Combo 3 Combo 3 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.26sec 0 300.36sec
Combo 3 Combo 3 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 3 Combo 3 elemental_focusing_lens_onyx 461191 6048245 20137 4.48 269682 0 22.4 22.4 0.0% 0.0% 0.0% 0.0% 12.97sec 6048245 300.36sec
Combo 3 Combo 3 eviscerate 196819 77023998 256440 13.73 858436 1757670 68.7 68.7 29.2% 0.0% 0.0% 0.0% 4.37sec 100193683 300.36sec
Combo 3 Combo 3 eviscerate_bonus 328082 33120662 110270 13.48 377013 771306 67.5 67.5 28.9% 0.0% 0.0% 0.0% 4.45sec 33120662 300.36sec
Combo 3 Combo 3 flagellation 384631 306865 1022 0.74 69761 139703 3.7 3.7 18.4% 0.0% 0.0% 0.0% 91.34sec 306865 300.36sec
Combo 3 Combo 3 flagellation_damage 394757 6001485 19981 4.78 209643 420313 0.0 23.9 19.7% 0.0% 0.0% 0.0% 0.00sec 6001485 300.36sec
Combo 3 Combo 3 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 3 Combo 3 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 3 Combo 3 instant_poison 315585 3665633 12204 56.70 10794 21760 0.0 283.8 19.3% 0.0% 0.0% 0.0% 0.00sec 3665633 300.36sec
Combo 3 Combo 3 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.7 0.0 0.0% 0.0% 0.0% 0.0% 11.21sec 0 300.36sec
Combo 3 Combo 3 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 70.63sec 0 300.36sec
Combo 3 Combo 3 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 66.80sec 0 300.36sec
Combo 3 Combo 3 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.55sec 0 300.36sec
Combo 3 Combo 3 recuperator 426605 0 0 0.00 0 0 99.0 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.36sec
Combo 3 Combo 3 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 62.05sec 0 300.36sec
Combo 3 Combo 3 rupture ticks -1943 29632156 98774 33.53 135600 281028 9.5 167.6 28.3% 0.0% 0.0% 0.0% 31.40sec 29632156 300.36sec
Combo 3 Combo 3 rupture_replicating_shadows ticks -394031 5438038 18127 0.00 24968 51630 167.6 0.0 28.0% 0.0% 0.0% 0.0% 1.76sec 5438038 300.36sec
Combo 3 Combo 3 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 19.04sec 0 300.36sec
Combo 3 Combo 3 secret_technique_player 280720 20836714 69373 3.20 685038 2125319 0.0 16.0 42.8% 0.0% 0.0% 0.0% 0.00sec 27163092 300.36sec
Combo 3 Combo 3 secret_technique_clones 282449 60528396 201520 6.38 995575 3036698 0.0 32.0 44.1% 0.0% 0.0% 0.0% 0.00sec 60528396 300.36sec
Combo 3 Combo 3 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.86sec 0 300.36sec
Combo 3 Combo 3 shadow_blades_attack ticks -279043 31461672 104872 0.00 81591 0 385.6 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 31461672 300.36sec
Combo 3 Combo 3 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.23sec 0 300.36sec
Combo 3 Combo 3 shadowstrike 185438 35226646 117282 10.45 280522 916316 52.3 52.3 61.8% 0.0% 0.0% 0.0% 5.84sec 45932542 300.36sec
Combo 3 Combo 3 squall_sailors_citrine 462952 1157155 3853 0.48 400460 807739 2.4 2.4 19.0% 0.0% 0.0% 0.0% 68.11sec 1157155 300.36sec
Combo 3 Combo 3 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 3 Combo 3 storm_sewers_citrine 462958 0 0 0.48 0 0 2.4 2.4 0.0% 0.0% 0.0% 0.0% 70.40sec 1637268 300.36sec
Combo 3 Combo 3 storm_sewers_citrine_damage 468422 262208 873 0.48 91663 183417 2.4 2.4 19.9% 0.0% 0.0% 0.0% 70.40sec 262208 300.36sec
Combo 3 Combo 3 suffocating_darkness ticks -449217 14227547 47425 21.60 131804 0 19.3 108.0 0.0% 0.0% 0.0% 0.0% 15.79sec 14227547 300.36sec
Combo 3 Combo 3 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.39sec 0 300.36sec
Combo 3 Combo 3 thunderlords_crackling_citrine 462951 22047057 73402 7.41 496700 996514 37.1 37.1 19.5% 0.0% 0.0% 0.0% 8.04sec 22047057 300.36sec
Combo 3 Combo 3 undersea_overseers_citrine 462953 1328294 4422 0.46 480673 964419 2.3 2.3 19.7% 0.0% 0.0% 0.0% 79.74sec 1328294 300.36sec
Combo 3 Combo 3 unseen_blade 441144 25533848 85011 11.61 368003 740301 58.1 58.1 19.2% 0.0% 0.0% 0.0% 5.18sec 33354518 300.36sec
Combo 3 Combo 3 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.34sec 0 300.36sec
Combo 3 Combo 3 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 72.56sec 0 300.36sec
Combo 4 Combo 4 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 4 Combo 4 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.30sec 0 300.36sec
Combo 4 Combo 4 auto_attack_mh 0 13792929 45921 69.44 38490 77353 347.6 347.6 19.3% 16.4% 0.0% 0.0% 1.00sec 17999076 300.36sec
Combo 4 Combo 4 auto_attack_oh 1 6868092 22866 69.34 19171 38592 347.1 347.1 19.3% 16.4% 0.0% 0.0% 1.00sec 8962396 300.36sec
Combo 4 Combo 4 backstab 53 9414322 31344 14.92 76268 196339 74.7 74.7 41.5% 0.0% 0.0% 0.0% 3.74sec 12316975 300.36sec
Combo 4 Combo 4 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.78sec 0 300.36sec
Combo 4 Combo 4 coup_de_grace 441776 25667250 85455 7.87 503043 1012825 13.2 39.4 29.0% 0.0% 0.0% 0.0% 22.50sec 33425117 300.36sec
Combo 4 Combo 4 eviscerate_coup_de_grace_bonus 462244 10957284 36481 7.56 223492 448432 0.0 37.8 29.3% 0.0% 0.0% 0.0% 0.00sec 10957284 300.36sec
Combo 4 Combo 4 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 4 Combo 4 elemental_focusing_lens_onyx 461191 6035870 20096 4.47 269763 0 22.4 22.4 0.0% 0.0% 0.0% 0.0% 12.91sec 6035870 300.36sec
Combo 4 Combo 4 eviscerate 196819 73074125 243289 13.54 828699 1687008 67.8 67.8 29.1% 0.0% 0.0% 0.0% 4.45sec 95063277 300.36sec
Combo 4 Combo 4 eviscerate_bonus 328082 31432182 104649 13.29 363798 739877 66.5 66.5 29.0% 0.0% 0.0% 0.0% 4.53sec 31432182 300.36sec
Combo 4 Combo 4 flagellation 384631 324781 1081 0.74 73145 145917 3.7 3.7 19.4% 0.0% 0.0% 0.0% 91.38sec 324781 300.36sec
Combo 4 Combo 4 flagellation_damage 394757 5209583 17345 4.74 183341 364427 0.0 23.7 20.1% 0.0% 0.0% 0.0% 0.00sec 5209583 300.36sec
Combo 4 Combo 4 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 4 Combo 4 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 4 Combo 4 instant_poison 315585 3601157 11990 55.81 10781 21668 0.0 279.4 19.4% 0.0% 0.0% 0.0% 0.00sec 3601157 300.36sec
Combo 4 Combo 4 legendary_skippers_citrine 462962 0 0 0.00 0 0 24.8 0.0 0.0% 0.0% 0.0% 0.0% 11.62sec 0 300.36sec
Combo 4 Combo 4 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.2 0.0 0.0% 0.0% 0.0% 0.0% 71.14sec 0 300.36sec
Combo 4 Combo 4 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.2 0.0 0.0% 0.0% 0.0% 0.0% 74.51sec 0 300.36sec
Combo 4 Combo 4 phantom_reaping 448669 5954146 19823 3.71 268641 538487 18.6 18.6 19.2% 0.0% 0.0% 0.0% 15.60sec 5954146 300.36sec
Combo 4 Combo 4 phantom_reaping_echo 448669 1002529 3338 2.52 66345 133020 12.6 12.6 19.5% 0.0% 0.0% 0.0% 6.75sec 1002529 300.36sec
Combo 4 Combo 4 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.55sec 0 300.36sec
Combo 4 Combo 4 recuperator 426605 0 0 0.00 0 0 99.0 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.36sec
Combo 4 Combo 4 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 72.10sec 0 300.36sec
Combo 4 Combo 4 rupture ticks -1943 28556945 95190 32.83 133376 276242 9.6 164.1 28.4% 0.0% 0.0% 0.0% 31.35sec 28556945 300.36sec
Combo 4 Combo 4 rupture_replicating_shadows ticks -394031 5239894 17466 0.00 24539 50618 164.1 0.0 28.3% 0.0% 0.0% 0.0% 1.80sec 5239894 300.36sec
Combo 4 Combo 4 secret_technique 280719 0 0 0.00 0 0 15.9 0.0 0.0% 0.0% 0.0% 0.0% 19.09sec 0 300.36sec
Combo 4 Combo 4 secret_technique_player 280720 19343441 64401 3.19 679087 1899461 0.0 15.9 43.8% 0.0% 0.0% 0.0% 0.00sec 25220340 300.36sec
Combo 4 Combo 4 secret_technique_clones 282449 55975484 186362 6.35 985646 2733463 0.0 31.8 44.4% 0.0% 0.0% 0.0% 0.00sec 55975484 300.36sec
Combo 4 Combo 4 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.96sec 0 300.36sec
Combo 4 Combo 4 shadow_blades_attack ticks -279043 27837940 92793 0.00 73150 0 380.5 0.0 0.0% 0.0% 0.0% 0.0% 1.21sec 27837940 300.36sec
Combo 4 Combo 4 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.34sec 0 300.36sec
Combo 4 Combo 4 shadowstrike 185438 33711058 112236 10.44 280819 873892 52.3 52.3 61.4% 0.0% 0.0% 0.0% 5.84sec 43960278 300.36sec
Combo 4 Combo 4 squall_sailors_citrine 462952 1056449 3517 0.44 400401 802660 2.2 2.2 20.9% 0.0% 0.0% 0.0% 73.54sec 1056449 300.36sec
Combo 4 Combo 4 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Combo 4 Combo 4 storm_sewers_citrine 462958 0 0 0.45 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 75.72sec 1551012 300.36sec
Combo 4 Combo 4 storm_sewers_citrine_damage 468422 248771 828 0.45 91307 184497 2.3 2.3 20.0% 0.0% 0.0% 0.0% 75.72sec 248771 300.36sec
Combo 4 Combo 4 suffocating_darkness ticks -449217 13875338 46251 21.21 130828 0 18.7 106.1 0.0% 0.0% 0.0% 0.0% 15.68sec 13875338 300.36sec
Combo 4 Combo 4 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.40sec 0 300.36sec
Combo 4 Combo 4 thunderlords_crackling_citrine 462951 21662511 72122 7.29 497041 996632 36.5 36.5 19.3% 0.0% 0.0% 0.0% 7.93sec 21662511 300.36sec
Combo 4 Combo 4 undersea_overseers_citrine 462953 1268905 4225 0.44 480936 965765 2.2 2.2 18.3% 0.0% 0.0% 0.0% 74.72sec 1268905 300.36sec
Combo 4 Combo 4 unseen_blade 441144 25191800 83872 11.53 364281 731514 57.7 57.7 19.6% 0.0% 0.0% 0.0% 5.17sec 32913686 300.36sec
Combo 4 Combo 4 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.30sec 0 300.36sec
Combo 4 Combo 4 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 72.01sec 0 300.36sec
Equipped Equipped augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Equipped Equipped auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.25sec 0 300.36sec
Equipped Equipped auto_attack_mh 0 14074388 46859 70.94 38376 77398 355.1 355.1 19.3% 16.3% 0.0% 0.0% 0.98sec 18362441 300.36sec
Equipped Equipped auto_attack_oh 1 7006811 23328 70.83 19120 38567 354.6 354.6 19.3% 16.3% 0.0% 0.0% 0.98sec 9141695 300.36sec
Equipped Equipped backstab 53 9098733 30293 15.08 72891 188936 75.5 75.5 41.1% 0.0% 0.0% 0.0% 3.67sec 11904413 300.36sec
Equipped Equipped cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.71sec 0 300.36sec
Equipped Equipped coup_de_grace 441776 26939011 89689 7.96 522508 1048567 13.3 39.8 29.3% 0.0% 0.0% 0.0% 22.28sec 35071747 300.36sec
Equipped Equipped eviscerate_coup_de_grace_bonus 462244 11552493 38462 7.67 231227 467619 0.0 38.4 29.6% 0.0% 0.0% 0.0% 0.00sec 11552493 300.36sec
Equipped Equipped cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.18sec 0 300.36sec
Equipped Equipped elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Equipped Equipped elemental_focusing_lens_onyx 461191 6020766 20045 4.46 269756 0 22.3 22.3 0.0% 0.0% 0.0% 0.0% 12.94sec 6020766 300.36sec
Equipped Equipped eviscerate 196819 76958346 256221 13.73 856763 1755933 68.7 68.7 29.2% 0.0% 0.0% 0.0% 4.38sec 100110524 300.36sec
Equipped Equipped eviscerate_bonus 328082 33103865 110214 13.47 376874 768481 67.4 67.4 29.1% 0.0% 0.0% 0.0% 4.46sec 33103865 300.36sec
Equipped Equipped flagellation 384631 310057 1032 0.74 69676 139347 3.7 3.7 19.8% 0.0% 0.0% 0.0% 91.36sec 310057 300.36sec
Equipped Equipped flagellation_damage 394757 6012391 20017 4.77 209728 421069 0.0 23.9 19.8% 0.0% 0.0% 0.0% 0.00sec 6012391 300.36sec
Equipped Equipped flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Equipped Equipped food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Equipped Equipped instant_poison 315585 3664846 12202 56.70 10794 21701 0.0 283.8 19.4% 0.0% 0.0% 0.0% 0.00sec 3664846 300.36sec
Equipped Equipped legendary_skippers_citrine 462962 0 0 0.00 0 0 25.3 0.0 0.0% 0.0% 0.0% 0.0% 11.94sec 0 300.36sec
Equipped Equipped mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.2 0.0 0.0% 0.0% 0.0% 0.0% 67.38sec 0 300.36sec
Equipped Equipped old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 67.93sec 0 300.36sec
Equipped Equipped potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.56sec 0 300.36sec
Equipped Equipped recuperator 426605 0 0 0.00 0 0 99.0 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.36sec
Equipped Equipped roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 73.51sec 0 300.36sec
Equipped Equipped rupture ticks -1943 29626978 98757 33.52 135747 281047 9.5 167.6 28.2% 0.0% 0.0% 0.0% 31.31sec 29626978 300.36sec
Equipped Equipped rupture_replicating_shadows ticks -394031 5464057 18214 0.00 24922 51908 167.6 0.0 28.5% 0.0% 0.0% 0.0% 1.76sec 5464057 300.36sec
Equipped Equipped secret_technique 280719 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 18.97sec 0 300.36sec
Equipped Equipped secret_technique_player 280720 20986638 69872 3.21 683882 2111099 0.0 16.1 43.7% 0.0% 0.0% 0.0% 0.00sec 27355635 300.36sec
Equipped Equipped secret_technique_clones 282449 60611270 201796 6.40 993114 3037274 0.0 32.0 44.0% 0.0% 0.0% 0.0% 0.00sec 60611270 300.36sec
Equipped Equipped shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.91sec 0 300.36sec
Equipped Equipped shadow_blades_attack ticks -279043 31531163 105104 0.00 81689 0 386.0 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 31531163 300.36sec
Equipped Equipped shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.17sec 0 300.36sec
Equipped Equipped shadowstrike 185438 35221476 117265 10.47 280760 916737 52.4 52.4 61.5% 0.0% 0.0% 0.0% 5.80sec 45925803 300.36sec
Equipped Equipped squall_sailors_citrine 462952 1124042 3742 0.47 401836 804088 2.3 2.3 19.5% 0.0% 0.0% 0.0% 71.36sec 1124042 300.36sec
Equipped Equipped stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.36sec
Equipped Equipped storm_sewers_citrine 462958 0 0 0.46 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 76.55sec 1579118 300.36sec
Equipped Equipped storm_sewers_citrine_damage 468422 252594 841 0.46 91562 183642 2.3 2.3 19.8% 0.0% 0.0% 0.0% 76.55sec 252594 300.36sec
Equipped Equipped suffocating_darkness ticks -449217 14242999 47477 21.56 132133 0 19.1 107.8 0.0% 0.0% 0.0% 0.0% 15.16sec 14242999 300.36sec
Equipped Equipped symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.40sec 0 300.36sec
Equipped Equipped thunderlords_crackling_citrine 462951 22098191 73573 7.47 496871 994599 37.4 37.4 18.9% 0.0% 0.0% 0.0% 7.84sec 22098191 300.36sec
Equipped Equipped undersea_overseers_citrine 462953 1333168 4439 0.46 481567 964450 2.3 2.3 18.9% 0.0% 0.0% 0.0% 70.44sec 1333168 300.36sec
Equipped Equipped unseen_blade 441144 25671727 85470 11.64 367783 740129 58.3 58.3 19.6% 0.0% 0.0% 0.0% 5.15sec 33535494 300.36sec
Equipped Equipped vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.25sec 0 300.36sec
Equipped Equipped windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 82.22sec 0 300.36sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health6,926,424.90.00.00%0.0100.0%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Fazed8.849.435.5s5.2s30.4s89.41%89.48%49.4 (49.4)7.9

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 162.9s
  • trigger_min/max:1.0s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 162.8s
  • uptime_min/max:80.26% / 98.88%

Stack Uptimes

  • fazed_1:89.41%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.849.235.4s5.2s30.4s89.47%89.52%49.2 (49.2)7.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 155.8s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 154.9s
  • uptime_min/max:80.16% / 98.01%

Stack Uptimes

  • fazed_1:89.47%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.949.235.3s5.2s30.2s89.48%89.51%49.2 (49.2)8.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 155.4s
  • trigger_min/max:1.0s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 154.6s
  • uptime_min/max:80.60% / 98.44%

Stack Uptimes

  • fazed_1:89.48%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.749.435.8s5.2s30.7s89.44%89.53%49.4 (49.4)7.8

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 163.8s
  • trigger_min/max:1.0s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 163.4s
  • uptime_min/max:78.32% / 99.04%

Stack Uptimes

  • fazed_1:89.44%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.948.835.1s5.2s30.0s89.25%89.31%48.8 (48.8)8.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 163.9s
  • trigger_min/max:1.0s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 160.4s
  • uptime_min/max:79.06% / 98.84%

Stack Uptimes

  • fazed_1:89.25%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.778.765.0s3.6s60.4s94.66%94.67%78.7 (78.7)3.7

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 278.0s
  • trigger_min/max:1.0s / 45.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 351.4s
  • uptime_min/max:83.04% / 100.00%

Stack Uptimes

  • find_weakness_1:94.66%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.778.665.1s3.6s60.6s94.65%94.63%78.6 (78.6)3.7

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 326.5s
  • trigger_min/max:1.0s / 43.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 326.3s
  • uptime_min/max:82.86% / 100.00%

Stack Uptimes

  • find_weakness_1:94.65%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.778.365.1s3.6s60.6s94.60%94.61%78.3 (78.3)3.7

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 278.6s
  • trigger_min/max:1.0s / 45.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 331.8s
  • uptime_min/max:81.46% / 100.00%

Stack Uptimes

  • find_weakness_1:94.60%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.678.765.7s3.6s61.1s94.73%94.73%78.7 (78.7)3.7

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 343.7s
  • trigger_min/max:1.0s / 43.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 340.3s
  • uptime_min/max:80.82% / 100.00%

Stack Uptimes

  • find_weakness_1:94.73%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.678.666.2s3.6s61.2s94.63%94.66%78.6 (78.6)3.7

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 278.3s
  • trigger_min/max:1.0s / 52.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 359.0s
  • uptime_min/max:82.27% / 100.00%

Stack Uptimes

  • find_weakness_1:94.63%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation3.70.091.0s91.3s11.8s14.65%22.22%0.0 (0.0)3.6

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.1s
  • trigger_min/max:90.0s / 98.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s
  • uptime_min/max:12.87% / 16.95%

Stack Uptimes

  • flagellation_1:14.65%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.1s91.3s11.8s14.63%22.21%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 97.8s
  • trigger_min/max:90.0s / 97.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.93% / 16.89%

Stack Uptimes

  • flagellation_1:14.63%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.64%22.26%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.4s
  • trigger_min/max:90.0s / 98.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.93% / 16.92%

Stack Uptimes

  • flagellation_1:14.64%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.63%22.24%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.2s
  • trigger_min/max:90.0s / 98.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.99% / 16.90%

Stack Uptimes

  • flagellation_1:14.63%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.65%22.29%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.3s
  • trigger_min/max:90.0s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.85% / 16.89%

Stack Uptimes

  • flagellation_1:14.65%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1315
Mean 300.36
Minimum 240.36
Maximum 359.90
Spread ( max - min ) 119.55
Range [ ( max - min ) / 2 * 100% ] 19.90%
DPS
Fluffy_Pillow Damage Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1315
Mean 7323756.17
Minimum 6836446.02
Maximum 7812217.29
Spread ( max - min ) 975771.27
Range [ ( max - min ) / 2 * 100% ] 6.66%
Standard Deviation 174026.4496
5th Percentile 7039721.50
95th Percentile 7587703.93
( 95th Percentile - 5th Percentile ) 547982.43
Mean Distribution
Standard Deviation 4799.0181
95.00% Confidence Interval ( 7314350.26 - 7333162.07 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2169
0.1 Scale Factor Error with Delta=300 258531931
0.05 Scale Factor Error with Delta=300 1034127722
0.01 Scale Factor Error with Delta=300 25853193034
HPS
Fluffy_Pillow Healing Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1315
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health025767981250
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.